KEGG   Oryctolagus cuniculus (rabbit): 100348211
Entry
100348211         CDS       T03373                                 
Symbol
SLIT2
Name
(RefSeq) slit guidance ligand 2
  KO
K06839  slit 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100348211 (SLIT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348211 (SLIT2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100348211 (SLIT2)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 EGF Laminin_G_1 Laminin_G_2 LRRNT LRR_9 LRRCT hEGF EGF_3 FXa_inhibition
Other DBs
NCBI-GeneID: 100348211
NCBI-ProteinID: XP_002709418
Ensembl: ENSOCUG00000009517
LinkDB
Position
2:10849860..11247761
AA seq 1525 aa
MRGVGWQTLPLSLGLVLAILSEVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERL
DLNGNNITRITKTDFAGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNKNHLQLFPE
LLFLGTAKLYRLDLSENQIQAIPRKAFRGAVDIKNLQLDYNQISCIEDGAFRALRDLEVL
TLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLRQRPRVGLYTQCMGPS
HLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPTACTCSNNIVDCRGKGLTEIPTNLPE
TITEIRLEQNAIKVIPPGAFSPYKKFRRNVEGHDLSNNQISELAPDAFQGLRSLNSLVLY
GNKITELPKSLFEGLFSLQLLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTF
SPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPIETSGARCTSPRRLANKRIGQIKSKKF
RCSGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLNKIPDHIPQYTAELRLNNNE
FTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHKMFKG
LESLKTLMLRSNRISCVGNDSFIGLGSVRLLSLYDNQITTIAPGAFDTLHSLSTLNLLAN
PFNCNCHLAWLGEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPL
SRCPTECTCLDTVVRCSNKGLKVLPKGIPRDVTELYLDGNQFTLLPKELSNYKHLTLIDL
SNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLKSLRLLSLHGNDISVVPEGA
FNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTTPSKK
FTCQGPVDVNILAKCNPCLSNPCKNDGTCNNDPVDFYRCTCPYGFKGQDCDIPIHACISN
PCKHGGTCHLKEGEKDGFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLC
PPEFTGELCEEKLDFCAQDLNPCQHDSKCILTPKGFKCDCTPGYIGEHCDIDFDDCQDNK
CKNGAHCTDAVNGYTCTCPDGYSGLFCEFSPPMVLPRTSPCDNFDCQNGAQCIIRMNEPI
CQCLPGYQGEKCEKLVSVNFVNKESYLQIPSAKVRPQTNITLQIATDEDSGILLYKGDKD
HIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGSPKVI
TNLSKQSTLNFDSPLYVGGMPGKNNVASLRQAPGQNGTSFHGCIRNLYINSELQDFRKVP
MQTGILPGCEPCHKKVCAHGTCRPSSQSGFSCECEEGWTGPLCDQRTNDPCVGNKCVHGT
CLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGKCRLSGLGQPYCECSSGYVG
DSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECKGGCAGGQCCAPLRSKRRKYSF
ECTDGSSFVDEVEKVVKCGCTRCAS
NT seq 4578 nt   +upstreamnt  +downstreamnt
atgcgcggcgttggctggcagacactgcccctgtcgctggggttggtgctggcgatcctg
agtgaggtggcgccgcaggcgtgcccggcgcagtgctcctgctccggcagcacggtggac
tgtcacgggctggcgctgcgcagcgtgcccaggaacattccccgcaacaccgagagactg
gatttgaatggaaataacatcacgcggattacgaagacagattttgctggccttagacat
ctgagagttcttcagcttatggagaataagattagcaccattgaaagaggagcattccag
gatctgaaagaactggaaagactgcgtttaaacaaaaatcaccttcagctgtttcctgag
ttgctgtttcttgggactgcgaagttatacaggctcgatctcagtgaaaatcaaatccag
gcaattccaaggaaggctttccgtggagcagttgacattaagaatttgcagctggattac
aaccagatcagctgtattgaagatggggcatttagggctctccgggacctggaagtgctc
actctcaacaataataacattactagactttctgtggcaagtttcaaccatatgcccaaa
cttaggacttttcgactccattcgaacaacctgtattgtgactgccacctggcctggctt
tccgactggcttcgccaaagacctcgcgtgggcttgtacactcagtgtatgggcccttcc
cacctgaggggccataacgtagctgaggttcaaaaacgagaatttgtctgcagtggccac
cagtcattcatggctccttcttgtagtgttttacactgccctactgcctgcacctgtagc
aacaatattgtagactgtcgtgggaaaggactcactgagatccccacaaacctgccggag
accatcacagaaatacgtttggaacagaatgcaatcaaggtcatccctcctggagctttc
tcaccatacaagaagtttagaagaaatgtggagggacacgacctgagcaataatcagatc
tctgaactcgcgccagatgctttccaaggactgcgctctctgaattcacttgtcctgtat
ggaaataaaattacggaactccctaaaagtttatttgaaggactcttttccttacagcta
ctattattgaatgccaacaagataaactgccttcgggtagatgcttttcaggatctccac
aacttgaaccttctctccttgtatgacaacaagcttcagaccatcgccaaggggacattt
tctcctctccgggccattcaaaccatgcatttggcccagaaccccttcatttgtgactgc
catctgaagtggctggcggattatctccataccaaccccattgagaccagtggtgcccgc
tgcaccagcccccgccgtctggcgaacaaaagaatcggacagatcaaaagcaagaaattc
cgttgttcaggtacagaagattaccgatcaaaattaagtggagactgctttgcagacttg
gcctgccctgaaaagtgccgctgtgaggggaccacagtagactgctccaatcaaaagctc
aacaaaatcccagaccacatcccccagtacactgcagagctgcgtctcaataataatgaa
ttcacagtgttggaagctacaggaatctttaagaaactgcctcaattacgaaaaatcaac
ttcagcaacaataagatcacagatatcgaggagggagcctttgaaggagcttctggtgta
aatgaaatacttctcacaagtaatcgtctggaaaacgtccagcataagatgttcaaggga
ttggaaagcctcaaaaccctgatgttgagaagtaatcgaataagctgtgttgggaatgac
agttttataggacttggttctgtgcgtttgctttctttatatgataatcaaattactact
attgcaccaggggcatttgatacccttcattctttatctactctaaacctcttggccaat
ccttttaactgtaactgccacctggcttggctgggagagtggctccggaaaaaacgaatt
gtcacaggaaatcctcggtgccaaaagccgtacttcctcaaagaaatccccatccaggac
gtggccattcaggacttcacttgtgatgatggaaacgatgacaatagttgctccccactt
tctcgctgtcctacggagtgtacttgtctggatacagtagtccgatgtagcaacaagggc
ctgaaagtcttgccgaaaggtattccaagggatgtcaccgagttatatctggatgggaac
caatttactctgcttcccaaggaactctccaactacaaacatttaacacttatagaccta
agtaacaacagaataagcaccctttcaaatcagagcttcagcaacatgacccagctcctg
actctaattcttagttataaccgtctgagatgtattcctcctcgaaccttcgatggattg
aagtctcttcgactgctttctctacacggaaatgacatttctgttgtgcctgaaggtgcc
ttcaatgatctttctgcactatcacacctagcgattggagccaatcctctttactgtgat
tgtaacatgcagtggttgtccgactgggtgaagtcggaatataaggaacccggaattgct
cgctgtgctggtcctggagaaatggcagataaactgttactcacaactccctccaaaaaa
tttacgtgtcaaggtcccgtcgatgtcaatattcttgctaaatgtaatccctgcttatcc
aatccgtgcaaaaatgatggcacctgtaacaatgatcctgttgacttttatcgatgcacc
tgtccatatggtttcaaggggcaagactgtgacattcctattcatgcttgcatcagtaac
ccgtgtaaacatggaggaacttgccacttaaaggaaggggaaaaagatgggttctggtgt
atttgtgcagatggatttgaaggggaaaattgtgaagtcaatgttgatgattgtgaagat
aatgactgtgaaaataattctacatgtgtcgatggaattaataactatacctgcctgtgc
ccacctgagttcacaggcgagctttgtgaagaaaagcttgacttctgtgcccaggacctg
aacccctgccagcatgactccaagtgtatcctgacaccaaaaggcttcaagtgtgactgc
actccaggatacataggtgagcactgtgacattgactttgacgactgccaggacaacaag
tgtaaaaacggcgcccactgcacggatgcagtgaatggttacacatgcacctgccctgac
ggttacagtggcttgttctgtgagttttctccacccatggtcctccctcgtaccagcccc
tgtgataattttgattgccagaatggagcacagtgcatcatcaggatgaatgagcccata
tgtcaatgtttgcctggttaccagggagagaaatgtgagaaattggtcagtgtgaatttt
gtgaacaaagagtcttatcttcagatcccttcagccaaggtgcggcctcagacaaacatc
acactgcagattgccacagatgaagacagtggcatcctcctgtacaaaggtgacaaagac
catatcgccgtggaactgtaccggggtcgtgtccgtgccagctacgacactggctctcac
ccggcttctgcaatttacagtgtggagacgatcaatgatgggaacttccacattgtggag
ctgcttgccctggatcagagtctctccctttctgtggatggcgggagccccaaagtcatc
accaacttgtcaaagcagtccactctgaattttgactccccactctatgtaggaggcatg
cccgggaagaataatgtggcatcactgcgccaggcccctggacagaatggcaccagcttc
catggctgcatccggaacctatacatcaacagtgagctgcaagacttccggaaggtgccc
atgcaaacaggcatcctgcctggctgtgagccatgccacaagaaggtgtgtgcccatggc
acgtgcaggcccagcagtcagtcaggcttctcctgcgagtgtgaggaaggatggacgggg
cccctctgtgaccagcggaccaatgacccttgtgttggaaataaatgtgtacacggcacc
tgcttgcccatcaatgcattttcctacagctgtaagtgcctggagggtcatggaggagtc
ctgtgtgatgaggaggaagatttgttcaacccctgccaggcaatcaagtgcaagcacggc
aagtgcaggctctctggactcgggcagccctactgtgagtgcagcagtggctacgtcggt
gacagctgtgatcgagaaatctcctgtcgaggggagcgaataagagattactaccagaag
cagcagggctatgccgcctgccagacaaccaagaaagtctcccgtttggaatgcaaaggc
ggctgcgctggaggccagtgctgcgcaccgctgcggagcaagcggcggaaatactctttc
gaatgcacagatgggtcctcgtttgtggacgaggttgagaaggtggtgaaatgcggctgc
acgaggtgtgcatcctaa

DBGET integrated database retrieval system