KEGG   Oryctolagus cuniculus (rabbit): 100348267
Entry
100348267         CDS       T03373                                 

Symbol
STAT5B
Name
(RefSeq) signal transducer and activator of transcription 5B
  KO
K11224  signal transducer and activator of transcription 5B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04062  Chemokine signaling pathway
ocu04217  Necroptosis
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348267 (STAT5B)
   04630 JAK-STAT signaling pathway
    100348267 (STAT5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100348267 (STAT5B)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100348267 (STAT5B)
   04659 Th17 cell differentiation
    100348267 (STAT5B)
   04062 Chemokine signaling pathway
    100348267 (STAT5B)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100348267 (STAT5B)
   04935 Growth hormone synthesis, secretion and action
    100348267 (STAT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348267 (STAT5B)
   05207 Chemical carcinogenesis - receptor activation
    100348267 (STAT5B)
   05203 Viral carcinogenesis
    100348267 (STAT5B)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100348267 (STAT5B)
   05220 Chronic myeloid leukemia
    100348267 (STAT5B)
   05223 Non-small cell lung cancer
    100348267 (STAT5B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348267 (STAT5B)
   05161 Hepatitis B
    100348267 (STAT5B)
   05162 Measles
    100348267 (STAT5B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100348267 (STAT5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100348267 (STAT5B)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100348267 (STAT5B)
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100348267
NCBI-ProteinID: XP_017204828
Ensembl: ENSOCUG00000005078
LinkDB
Position
19
AA seq 786 aa
MAVWIQAQQLQGDALHQMQALYGQHFPIEVRHYLSQWIESQAWDSIDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETTLQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSGHLEDYSSMSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCEPATAKAVDGYVKPQIKQVVPEFANASGEGGA
SATYMDQAPSPAVCPQTHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQW
IPHAQS
NT seq 2361 nt   +upstreamnt  +downstreamnt
atggctgtgtggatacaagcccagcagctgcaaggagatgcccttcaccagatgcaagcg
ctgtacggccagcacttccccatcgaggtgcgccactacctgtcccagtggatcgaaagc
caagcctgggactcaatagatcttgataatccacaggagaatattaaggccacccagctc
ctggagggcctggtgcaagagctgcagaagaaggcggagcatcaggtgggggaagatggg
tttttactgaagatcaagctgggccactacgccacccagctccagaacacgtacgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaacgaacagaggctggtc
cgggaagccaacaatggtagttctcccgctgggagcctggccgacgccatgtcccagaag
caccttcagatcaaccagacgttcgaggagctgcggctggtcacgcaggacacggagaac
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagcccagtttgcgcaactggcccagctgaacccccaggagcggctgagcagg
gagacgaccctgcagcagaagcaggtgtccctggaggcctggctgcagcgtgaggcccag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagacgatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggccggcaacggagggccccctgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggctgagatcatctggcagaaccggcagcaaatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctccgccctggtgaccagcacattcatcatcgagaagcagcccccgcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaacgagtgcagcggcgagatcctgaacaactgc
tgtgtcatggaatatcaccaagccactggcaccctcagcgcccacttcaggaacatgtcc
ctgaaacgaatcaagaggtccgaccgccgtggagcggagtcggtgacagaagaaaaattt
accatcctgtttgaatcacagttcagcgttggggggaatgagctggtatttcaggtcaag
accctgtcactccccgtggtggtgatcgttcatggcagccaggacaacaacgcgacagcc
accgttctctgggacaatgcttttgccgagcctggcagagtgccattcgccgtgcctgac
aaagtgctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcggccacctggaggactacagcagcatgtccgtgtcctggtcccagttcaacagg
gagaacttgccaggacgaaattacaccttctggcagtggtttgacggggtgatggaagtg
ttgaaaaagcatctcaagcctcattggaacgatggggcgattctgggttttgtgaacaag
caacaggcccatgacttactcatcaacaagccagatgggaccttcctcctgagattcagc
gactcggaaatcggtggcatcaccattgcttggaagtttgattctcaggaaagaatgttt
tggaatctgatgccatttactaccagagacttctccatccggtccctggctgaccgcttg
ggggacttgaattaccttatatatgtgtttcctgatcggccaaaagacgaagtgtactcc
aagtattacacgcccgttccctgtgagcctgccaccgctaaggcggtggacgggtacgtg
aagccgcagatcaagcaagtggtccctgagtttgccaacgcgtctggagaggggggggcc
agcgccacctacatggaccaggccccgtccccggctgtgtgtccccagacgcactacaac
atgtacccacagaaccctgactccgtccttgacaccgatggggacttcgacctggaagac
acgatggacgtggcgcgccgcgtggaggagctcctgggccgccccatggacagtcagtgg
atcccccacgcccagtcgtga

KEGG   Oryctolagus cuniculus (rabbit): 100348518
Entry
100348518         CDS       T03373                                 

Name
(RefSeq) signal transducer and activator of transcription 5A
  KO
K11223  signal transducer and activator of transcription 5A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04217  Necroptosis
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04917  Prolactin signaling pathway
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu04935  Growth hormone synthesis, secretion and action
ocu05161  Hepatitis B
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05220  Chronic myeloid leukemia
ocu05221  Acute myeloid leukemia
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100348518
   04630 JAK-STAT signaling pathway
    100348518
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100348518
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100348518
   04659 Th17 cell differentiation
    100348518
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100348518
   04935 Growth hormone synthesis, secretion and action
    100348518
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100348518
   05207 Chemical carcinogenesis - receptor activation
    100348518
   05203 Viral carcinogenesis
    100348518
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100348518
   05220 Chronic myeloid leukemia
    100348518
   05223 Non-small cell lung cancer
    100348518
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348518
   05161 Hepatitis B
    100348518
   05162 Measles
    100348518
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100348518
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100348518
Transcription factors [BR:ocu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100348518
SSDB
Motif
Pfam: STAT_bind STAT_alpha STAT_int SH2
Other DBs
NCBI-GeneID: 100348518
NCBI-ProteinID: XP_002719440
Ensembl: ENSOCUG00000023066
UniProt: G1U4K1
LinkDB
Position
19
AA seq 793 aa
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDSPQDRAQAAQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGASPAGTLADALSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLNPQERLSRETTLQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNS
SSGHLEDYSSMSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPDRNLWNLKPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFANASGEGGASATYV
DQAPSPAVCPQTHYNMYPQNPDPVLDQEGEFDLDETMDVARHVEELLRRPMDGLNPRLSP
PAALFTAARSSLS
NT seq 2382 nt   +upstreamnt  +downstreamnt
atggcgggctggattcaggcccagcagctgcagggagacgcgctgcgccagatgcaggtg
ctctatggccagcacttccccatcgaggtccggcactacctggcacagtggatcgagagc
cagccatgggatgccatcgacctggacagcccccaggaccgagcccaggctgcccagctc
ctggagggcctggtgcaagagctgcagaagaaggcggagcatcaggtgggggaagatggg
tttttactgaagatcaagctgggccactacgccacccagctccagaacacgtacgaccgc
tgccccatggagctggtccgctgcatccggcacattctgtacaacgaacagaggctggtc
cgggaagccaacaatggcgcctctcccgctgggaccctggccgatgccttgtcccagaag
caccttcagatcaaccagacgttcgaggagctgcggctggtcacgcaggacacggagaat
gagctgaagaagctgcagcagactcaggagtacttcatcatccagtaccaggagagcctg
aggatccaagcccagtttgcgcagctggcccagctgaacccccaggagcggctgagcagg
gagacgaccctgcagcagaagcaggtgtccctggaggcctggctgcagcgtgaggcccag
acactgcagcagtaccgcgtggagctggccgagaagcaccagaagaccctgcagctgctg
cggaagcagcagacgatcatcctggacgacgagctgatccagtggaagcggcggcagcag
ctggcgggcaacggagggccccccgagggcagcctggacgtgctgcagtcctggtgtgag
aagttggctgagatcatctggcagaaccggcagcaaatccgcagagccgagcacctctgc
cagcagctgcccatccccggccccgtggaggagatgctggccgaggtcaacgccaccatc
acggacatcatctccgccctggtgaccagcacattcatcatcgagaagcagcccccgcag
gtcctgaagacccagaccaagttcgcggccaccgtgcgcctgctggtgggcgggaagctg
aacgtgcacatgaaccccccccaggtgaaggccaccatcatcagtgagcagcaggccaag
tccctgctcaagaacgagaacacccgcaacgagtgcagtggcgagatcctgaacaattgt
tgcgtcatggaatatcaccaagccaccggcaccctcagcgcccacttcaggaacatgtca
ctgaagaggatcaagcgtgcggaccgccggggtgcggagtcggtgacggaggagaagttc
acggtcctcttcgagtcgcagttcagcgttggcagcaatgagcttgtgttccaggtgaag
acgctgtccctccccgtggttgtcattgtccacggcagccaggaccacaacgccacggcc
actgtgctgtgggacaacgcctttgctgagccgggcagagtgccattcgccgtgcctgac
aaagtgctgtggccgcagctgtgcgaggcgctcaacatgaaattcaaggccgaggtgcag
agcaaccggggcctgaccaaggagaacctggtgttcctggcgcagaagctgttcaacagc
agcagcggccacctggaggactacagcagcatgtccgtgtcctggtcccagttcaacagg
gagaacctgcccggctggaactacaccttctggcagtggttcgatggggtgatggaggtg
ctgaagaagcatcacaagccgcactggaacgacggggccatcctcggttttgtgaataag
cagcaggcccacgacctgctcatcaacaagcccgatggcaccttcctgctgcgctttagc
gactcagaaatcgggggcatcaccatcgcctggaagtttgactcccctgaccgcaacctg
tggaacctgaagccgttcaccacgcgggatttctccattcggtccctggccgaccgcctg
ggagacctgaactatctcatctatgtctttccggaccgccccaaggacgaggtcttctcc
aagtactacacgcctgtgctcgctaaggcggtggacgggtatgtgaagccacagatcaag
caagtggtccctgagtttgccaacgcgtctggagaggggggggccagcgccacctacgtg
gaccaggccccgtccccggctgtgtgtccccagacgcactacaacatgtacccacagaac
ccggaccccgtcctggaccaggaaggagagttcgacttggacgagaccatggatgtggcc
cggcatgtggaggagctcctgcgccgccccatggacggtctcaacccgcgcctgtccccg
cccgccgcgctcttcacggctgccaggagctccctctcctga

DBGET integrated database retrieval system