KEGG   Oryctolagus cuniculus (rabbit): 100348517
Entry
100348517         CDS       T03373                                 
Symbol
CCL14
Name
(RefSeq) C-C motif chemokine ligand 14
  KO
K21092  C-C motif chemokine 14
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348517 (CCL14)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348517 (CCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348517 (CCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348517 (CCL14)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348517 (CCL14)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348517
NCBI-ProteinID: XP_002719291
Ensembl: ENSOCUG00000002849
UniProt: G1TNR8
LinkDB
Position
19:complement(24962125..24964790)
AA seq 94 aa
MKVSVAAIPLLLLFITPIALGSRAEFSPRGPYHPAECCFSYITRVVPRQRITDYYETSSE
CSKPGIVFITKKGYSICANPRDDWVQDYIRDLEK
NT seq 285 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccatccccctcctcctcctcttcatcacccccatcgcccta
ggatcccgggctgaattctccccacgaggcccctaccaccccgccgagtgctgcttctcc
tacatcacccgcgttgtcccccgtcagcggattacagattactacgagaccagcagcgag
tgctccaagcccggaattgtcttcatcaccaaaaagggctactcaatctgcgccaacccc
cgggatgactgggtccaggactacatcagggacctggagaagtga

DBGET integrated database retrieval system