KEGG   Oryctolagus cuniculus (rabbit): 100349708
Entry
100349708         CDS       T03373                                 
Symbol
GRK3, ADRBK2
Name
(RefSeq) G protein-coupled receptor kinase 3
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu04340  Hedgehog signaling pathway
ocu04724  Glutamatergic synapse
ocu04740  Olfactory transduction
ocu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100349708 (GRK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349708 (GRK3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100349708 (GRK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100349708 (GRK3)
  09157 Sensory system
   04740 Olfactory transduction
    100349708 (GRK3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100349708 (GRK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100349708 (GRK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349708 (GRK3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     100349708 (GRK3)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100349708 (GRK3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100349708 (GRK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS PH Pkinase_fungal Kinase-like HTH_WhiA ABC1
Other DBs
NCBI-GeneID: 100349708
NCBI-ProteinID: XP_017193452
Ensembl: ENSOCUG00000006729
UniProt: G1TYF2
LinkDB
Position
Un
AA seq 688 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKIVLPEPSIRSVMQKYLQERNEITFDKIFN
QKIGFLLFKDFCLNEINEAVPQVKFYEEIKEYEKLDNEEDRLCRSRQIYDAYIMKELLSC
SHPFSKQAVEHVQSHLSKKQVTSTLFQPYIEEICESLRGNIFQKFMESDKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMTYAFHTPDKLCFILDLMNGGDLHYHLSQHGVFSEKEMRFYATE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSRKKPHASVGTHGYMAPE
VLQKGTAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTVNVELPDTFSPE
LQSLLEGLLQRDVGKRLGCHGGGAQEVKEHSFFRGVDWQHVYLQKYPPPLIPPRGEVNAA
DAFDIGSFDEEDTKGIKLLDCDQELYKNFPLVISERWQQEVAETVYEAVNADTDKIEARK
RAKNKQLGHEEDYALGRDCIMHGYMLKLGSPFLTQWQRRYFYLFPNRLEWRGEGESRQSL
LTMEQIVSVEETQIKDKKCILFRIKAGKQFVLQCESDPEFVQWKKELTETFTEAQRLLRR
APKFLNKPRPGVMELSKPPLCHRNSNGL
NT seq 2067 nt   +upstreamnt  +downstreamnt
atggcggacctggaggccgtgctggccgatgtgagctacctgatggccatggagaagagc
aaggccacgccggctgcccgcgccagcaagaagatcgtcctgcccgagcccagtatccgg
agtgtgatgcagaagtaccttcaggagagaaatgaaataacctttgacaagattttcaat
cagaaaatcggtttcttgctatttaaagacttttgtttgaatgagattaacgaagctgta
cctcaggtgaagttttatgaagagatcaaagagtatgaaaagctcgacaatgaagaagac
cgcctgtgtagaagtcgccaaatctacgacgcctatatcatgaaggagctgctgtcctgt
tcgcacccattctcgaagcaagccgtggagcatgtgcaaagtcatctgtccaagaagcaa
gtgacatccaccctgttccagccgtacatagaagaaatctgtgaaagtcttcgaggcaac
atttttcaaaagtttatggaaagtgacaagttcactagattttgtcagtggaaaaacgta
gaattaaatatccatttgaccatgaatgatttcagcgtccacaggatcatcggacgagga
ggatttggagaagtgtatggctgcaggaaagcagacactggaaaaatgtacgcgatgaag
tgcttggacaagaagaggatcaagatgaaacaaggggaaacgctggccctgaacgagagg
atcatgctgtctcttgtcagtacgggagactgtcctttcattgtgtgtatgacctatgcc
ttccacactccagataaactctgcttcatcctggacctgatgaacgggggcgacctgcac
taccacctctcccagcacggggtgttctccgagaaggagatgcggttctacgccaccgag
atcatcctggggctggaacacatgcacaaccgctttgttgtctacagggatctgaagccc
gcaaatatcctcctggacgagcacggacacgtgaggatctcagacctcgggctcgcctgc
gatttctccaggaagaagccacacgcgagcgtgggcacccacgggtacatggctcccgag
gtgctgcagaaggggacagcctacgacagcagcgccgactggttctccctgggctgcatg
ctcttcaagctgctgcgaggccacagccctttcaggcagcacaaaaccaaagacaagcac
gagattgaccggatgacgctcaccgtgaacgtggagctccccgacaccttctccccggag
ctgcagtctctcttggaaggcctgctccagcgagacgtgggcaagcggctgggctgtcac
ggaggcggggcgcaggaagtgaaggagcacagcttcttcaggggcgtcgactggcagcac
gtctacttgcagaagtacccgccgcccttgattcctccccgtggagaagtcaacgccgcc
gacgcctttgacatcggctcctttgacgaagaggacaccaaaggcatcaagctgctggac
tgcgaccaagagctgtacaagaacttccccttggtcatctccgagcgctggcagcaggaa
gtcgccgaaacggtgtacgaagcagtgaacgcggacacggataaaattgaggccaggaag
agagcgaaaaataagcagcttgggcatgaggaagactacgccctgggcagagactgcatc
atgcacgggtacatgctgaagctgggcagccccttcctgacgcagtggcagcggcgctac
ttctacctcttccccaaccggctcgagtggagaggggagggcgagtctcggcaaagtttg
ctgacaatggagcagattgtatctgtggaagaaacgcagattaaagacaaaaaatgcatc
ttgttcagaataaaggcagggaagcagttcgtcttgcagtgtgagagcgatccagagttt
gtgcagtggaagaaggagttgacggaaacgttcacggaggcccagcggctcctgcgccgg
gcgcccaagttcctcaacaaaccccggccgggcgtcatggagctctccaagccacccctg
tgtcacaggaacagcaacggcctctga

KEGG   Oryctolagus cuniculus (rabbit): 100350579
Entry
100350579         CDS       T03373                                 
Symbol
GRK7
Name
(RefSeq) G protein-coupled receptor kinase 7
  KO
K00909  rhodopsin kinase [EC:2.7.11.14]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350579 (GRK7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100350579 (GRK7)
  09157 Sensory system
   04744 Phototransduction
    100350579 (GRK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100350579 (GRK7)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     100350579 (GRK7)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100350579 (GRK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like
Other DBs
NCBI-GeneID: 100350579
NCBI-ProteinID: XP_002716609
Ensembl: ENSOCUG00000000636
UniProt: G1SDR1
LinkDB
Position
14:35239743..35274064
AA seq 553 aa
MVDMGGLDNLIANTAYLQARNTSEVDSRELQRRRRSLALPGPQACAELRRELPAHFHSLC
EQQPIGRRLFRDFLATVPAYREATAFLEEVQSWELAEEGPAKGSALQGLVAACAQGLAPG
QPLAFLSPALAAKSQAATTEEEQAAVVTLAQAETMAFLQEQPFREFLASPFYEKFLQWKL
FEMQPVSEKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKNGEKMALLEK
EILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYSVGSRGLAMERVVFYSAQM
TCGVLHLHTLGIVYRDMKPENVLLDDLGNCRLSDLGLAVQVQDDKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKISKEDLKQRTLKEEVVFQHDGFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHPFFQTINFPRLEAGLVEPPFVPDPSVVYA
KDIDEIEDFSEVRGVEFDDKDKKFFQRFATGAVPIAWQEEIIETGLFEELNDPNRPVGYG
KGNSSKSGVCVLL
NT seq 1662 nt   +upstreamnt  +downstreamnt
atggtcgacatggggggcctggacaacctcatcgccaacacggcctacctgcaggcccgg
aacacttcggaagttgacagccgcgagctgcagcggcggcgccggagcctggcgctgccc
ggcccgcaggcctgcgccgagctccgccgggagctgcccgcacacttccacagcctctgc
gagcagcagcccattggccgccgcctcttccgcgacttcctggccacggtgccggcgtac
cgcgaggccacggccttcctggaagaggtgcagagctgggagctggccgaggaggggccg
gccaagggcagcgcgctgcaggggctggtggccgcctgtgcccaaggcctggccccaggg
cagccgctggccttccttagcccagctctggccgccaagagccaagcggctaccacagag
gaggagcaggccgccgtggtgacgctggcgcaggcagagaccatggccttcctgcaggag
cagcccttccgcgagtttctggccagccccttctacgagaagtttctgcagtggaaactc
tttgagatgcagccggtgtcagagaagtacttcacggagttccgggtgctgggcaaaggg
ggtttcggggaggtctgcgccgtccaggtgaagaacaccggtaagatgtatgcttgtaaa
aaactggacaagaagcggctgaagaagaaaaatggtgagaagatggctctcttagaaaag
gagatcttggagaaagtgagcagccctttcatcgtctccctggcctatgcctttgagagc
aagacccatctctgcctggtcatgagtctgatgaacgggggagacctcaagttccacatc
tacagtgtaggctcacggggcctggccatggagcgggtggtcttctactcagcccagatg
acctgcggagtgctgcacctccacacccttggcatcgtctaccgggacatgaagccagag
aacgtgctgctggatgaccttggcaactgcaggctgtccgacctggggctggccgtgcag
gtgcaagacgacaagcccatcacgcagagggctggaaccaatggttacatggctcccgag
atccttatggaaaaggtgagttattcctaccctgtggactggtttgcgatgggatgcagt
atttatgaaatggttgctggacgaaccccattcaaagattacaaggaaaagatcagcaaa
gaagacctaaagcaaagaaccctgaaagaagaggttgtattccaacatgatggcttcaca
gaggaagcaaaagatatctgcaggctcttcctggctaagaagccggagcagcgcttagga
agcagagaaaagtctgatgatcccaggaaacaccctttcttccaaaccatcaactttccc
cgcctggaggccggcctggttgaacccccatttgtgccagacccttcggtagtttatgcc
aaagacatcgatgaaattgaagatttctctgaggttcggggggtagaatttgatgacaaa
gataagaagttcttccaaagatttgcaactggggctgtccccatcgcatggcaggaagaa
attatagaaacaggactgtttgaggaactgaatgaccccaacaggcctgtgggttatggg
aagggtaactcctccaagtccggggtgtgtgtgttattgtga

KEGG   Oryctolagus cuniculus (rabbit): 100351551
Entry
100351551         CDS       T03373                                 
Symbol
GRK4
Name
(RefSeq) G protein-coupled receptor kinase 4
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351551 (GRK4)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100351551 (GRK4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100351551 (GRK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100351551 (GRK4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     100351551 (GRK4)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100351551 (GRK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100351551
NCBI-ProteinID: XP_008248078
Ensembl: ENSOCUG00000005838
UniProt: G1SPS3
LinkDB
Position
Un
AA seq 572 aa
MEVENITANTLLLRARLGGYGKKSGRSKKWKEILKLPAVSQCSELRQSIERDYCSLCDKQ
PIGRLLFRQFCDTKPGLKRRIEFLDAVAEYEVAIDEDQEHCGLCILEEFFSNEKSAVCLP
EIPPGVVKECKLRLKQNPSKKAFEECTGIVHSYLSKKPFEEYQESSYFSRFLQWKWLERQ
PVTKNTFRHYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKKLLE
KVNSRFVVSLAYTYETKDTLCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFYAAELCCGL
EDLQRERIVYRDLKPENILLDDHGHIRISDLGLALEVPEGETVRGRVGTVGYMAPEVIDN
ENYTFSPDWWGLGCLIYEMIQGHSPFRKFKEKVKREEIERRVKTDTEVYSAKFSADARSI
CRMLLTKNPKDRLGCRGEGAAGVKRHPVFQDINFSRLEVHLLAAPFYPDPHSVYCKDVLD
IGQFSVIKGVYLDTTDSSFYAQFVTGCVPIPWQNEMIESGCFKDINESESEENLLVEEKR
RTSVHKPKRNFFYRLFRRGGCLSVEKEAEPSC
NT seq 1719 nt   +upstreamnt  +downstreamnt
atggaggtcgagaacatcacggccaacacgttgctgctgagagcgcgcctaggaggatat
ggcaaaaaaagcggtcgcagtaaaaaatggaaggagatcctgaagctgccggctgtgagc
cagtgcagcgagctcaggcagtcgattgaaagggattattgtagtctttgtgacaaacag
ccaataggaagacttctcttcaggcaattttgtgacacaaaacctggtctaaagaggcgc
attgaattcttggacgcagtggcagaatatgaagttgccatagatgaggaccaagaacat
tgtggactgtgcattctagaggaattcttcagcaatgagaaatcggcagtctgtttacca
gaaatacctccaggtgttgtgaaagaatgtaaactgaggctgaagcagaacccttccaaa
aaagcctttgaggaatgcactggaattgtccatagctatttaagcaaaaaaccatttgaa
gaataccaagaaagctcatatttttctcggtttttacaatggaaatggctggaaaggcaa
ccagtaacaaagaacacatttagacattacagagttctaggaaaaggcggatttggagag
gtttgtgcctgtcaagtgcgagccacaggaaaaatgtatgcctgtaaaaagctagaaaaa
aaaagaataaagaagaggaaaggtgaagccatggctttgaacgagaaaaaactgctagaa
aaagtgaacagcagatttgtagttagtttagcctacacttacgaaaccaaagacaccctg
tgtttggtgctgaccatcatgaatggaggggacttgaagtttcacatttacaacctgggc
aaccctggctttgatgagcagagagccgtcttctatgctgcagagctgtgctgcggtttg
gaggatttgcagagggaacggattgtatacagagatttaaagcctgagaatattctcctg
gacgaccacggacatatccggatttcagatcttggcttggccctggaggtcccggaaggg
gagacagttcgaggaagggtcggaacagtcggctacatggctcctgaagttatcgataat
gaaaactacacctttagccctgattggtgggggcttggctgtctgatttatgaaatgatc
caggggcattctccgttcaggaagttcaaggagaaggtgaagcgggaggagatcgagcgc
agagtgaagacggacactgaggtttattccgccaagttctccgcggatgccaggtccatc
tgcaggatgttgctcaccaagaaccccaaggaccggctgggctgcaggggcgaaggagct
gcgggggtgaagcggcaccccgtgtttcaggacatcaacttcagcaggctggaggtgcac
ctgttagctgcccccttctaccctgatcctcattcggtttactgtaaggatgtcctggat
atcgggcagttctctgtcatcaaaggagtctacctggacaccacagacagcagcttctac
gctcagtttgttacgggctgtgtccccatcccctggcagaacgagatgatcgagtctggg
tgtttcaaggacatcaatgaaagtgaaagtgaggaaaacctgcttgtggaggagaaacga
cgcacttcagtccataagccaaagagaaacttcttctacagactcttccgaagagggggc
tgcctgagcgtcgagaaggaagcggagccgagctgctga

KEGG   Oryctolagus cuniculus (rabbit): 100357639
Entry
100357639         CDS       T03373                                 
Symbol
GRK6
Name
(RefSeq) G protein-coupled receptor kinase 6
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100357639 (GRK6)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100357639 (GRK6)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    100357639 (GRK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100357639 (GRK6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     100357639 (GRK6)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   100357639 (GRK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100357639
NCBI-ProteinID: XP_008253692
Ensembl: ENSOCUG00000005920
LinkDB
Position
3:57940158..57954254
AA seq 582 aa
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVAEYEVTPDEKRKACGRRLMQDFLSHTGPDLIPE
VPRQLVTNCAQQLEQGPCKDLFQELTRLTHEYLSVAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVKNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVREVPEEYSERFSPQARSLC
SQLLCKDPAERLGCRGGAAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVELEPTDQDFYQKFATGSVPIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPPAPPKKGLLQRLFSRQDCCGNCSDSEEEPPTRLEPPTRL
NT seq 1749 nt   +upstreamnt  +downstreamnt
atggagctcgagaacatcgtagcgaacaccgtgctcctcaaggcccgggaaggtggtgga
gggaatcgcaaaggcaaaagcaagaaatggcggcagatgctccaatttccccacatcagc
cagtgtgaagagctgcggctcagccttgaacgtgactaccacagcctgtgcgagcggcag
cccatcggccgcctgctgttccgcgagttctgcgccacgaggcccgagctgacccgctgc
actgccttcctggacggggtggctgagtacgaagtgacccctgatgagaagcggaaggcg
tgtgggcggcggctaatgcaggattttctgagccacacgggtcctgacctcatccccgag
gtgccccggcaactggtgactaactgtgcacagcaactggagcaggggccctgcaaagac
ctcttccaggaactcacccggctgacccacgagtacctgagcgtagccccctttgccgac
tacctcgacagcatctacttcaaccgtttcctgcagtggaagtggctagaaaggcagcca
gtgaccaaaaacaccttcaggcagtaccgagtgctgggcaaaggcggctttggggaggtg
tgtgcctgccaggtgcgggccacaggcaagatgtacgcctgcaagaagctggagaagaaa
cgcatcaagaagcggaaaggggaagccatggcgctcaacgagaagcagatcctggagaaa
gtgaacagtaggtttgtagtgagcttggcctatgcctatgagaccaaggatgccctgtgc
ctggtgctgacgctgatgaacggcggcgacctcaagttccacatctaccacatgggccag
gctggcttccctgaggcgcgcgccgtcttctacgccgcggaaatctgctgcggcctggag
gacctgcaccgggagcgcatcgtgtacagagacctgaagccagagaacattctgctggat
gaccacggccacatccgcatctctgacctgggcctggctgtgcacgtgcccgagggccag
accatcaaaggccgcgtaggcaccgtgggctacatggctccggaggtggtgaagaacgaa
cggtacacgttcagccccgactggtgggcgcttggctgcctcctctatgagatgatcgcc
ggccagtcgcccttccagcagaggaagaagaagatcaagcgggaggaggtagaacggctg
gtgagggaagtgcccgaggagtactcggagcgcttctccccgcaggcccgctcgctctgc
tcccagctcctctgcaaagaccctgccgagcgcctgggctgccgcgggggtgctgcccga
gaggtgaaggagcaccccctcttcaagaagctgaacttcaagcggctgggagctggcatg
ctggagccgcccttcaagcctgacccccaggctatttattgcaaggatgttctggacatc
gaacagttctccacagtgaagggcgtggagctggagcccacagaccaggacttctaccag
aagtttgccacagggagtgtgcccatcccctggcagaacgagatggtggagacggagtgc
ttccaggagctcaatgtctttgggctggacggctcggttcccccagacctggactggaag
ggccagccaccggcgccccccaaaaagggcctgctgcagagactcttcagtcgccaggat
tgctgtgggaactgcagcgacagtgaagaagagccccccacccgcctcgagccccccacc
cgcctctag

KEGG   Oryctolagus cuniculus (rabbit): 103345045
Entry
103345045         CDS       T03373                                 
Symbol
GRK2, ADRBK1
Name
(RefSeq) G protein-coupled receptor kinase 2
  KO
K00910  beta-adrenergic-receptor kinase [EC:2.7.11.15]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu04340  Hedgehog signaling pathway
ocu04724  Glutamatergic synapse
ocu04740  Olfactory transduction
ocu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    103345045 (GRK2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103345045 (GRK2)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103345045 (GRK2)
  09156 Nervous system
   04724 Glutamatergic synapse
    103345045 (GRK2)
  09157 Sensory system
   04740 Olfactory transduction
    103345045 (GRK2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    103345045 (GRK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    103345045 (GRK2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    103345045 (GRK2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.15  beta-adrenergic-receptor kinase
     103345045 (GRK2)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   103345045 (GRK2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103345045 (GRK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 103345045
NCBI-ProteinID: XP_017202475
LinkDB
Position
1:194744059..194751559
AA seq 720 aa
MADLEAVLADVSYLMAMEKSKATPAARASKKILLPEPSIRSVMQKYLEDRGEVTFEKIFS
QKLGYLLFRDFCLNHLEEARPLVEFYEEIRKYEKLETEEERVARSREIFDSYIMKELLAC
SHPFSKSATEHVQGHLVKKQVPPDLFQPYIEEICQNLRGDVFRKFIESEKFTRFCQWKNV
ELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQGETLALNER
IMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSEADMRFYAAE
IILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVGTHGYMAPE
VLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAVELPDSFSPE
LRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFPLPGLADGLPAEVPSPADPPARGGERG
RRLRHRLLRRGGHERDQVAGQRPGALPQLPPHHLGAVAAGGGRDGLRHHQRRDRPAGGAQ
EGQEQAAGPRGRLRPGQGLHHAWLHVQDGQPLPDPVAAAVLLPVPQPARVAGRGRGPAEP
ADHGGDPVGGGDADQGAQVPAAQDPRGQAVRAAVRQRPRAGAVEEGASRRLPRGAAAGAA
GAPDEEQAALARGGAQQGAAGAAQQRQRPVSRPAAFCRPLIYFVGFLLFVFPQSGKGFIL
NT seq 2163 nt   +upstreamnt  +downstreamnt
atggcggacctggaggcggtgctggccgacgtgagctacctgatggccatggagaagagc
aaggccacgccggcggcgcgcgccagcaagaagatcctgctgcccgagcccagcatccgc
agtgtcatgcagaagtacttggaggaccggggcgaggtgacgtttgagaagatcttctcc
cagaagctggggtacctgctgttccgagacttctgcctgaaccatctggaggaggccagg
cccttggtggagttctacgaggagatcaggaagtatgagaagctggagacggaggaggag
cgcgtggcccgcagccgggagatctttgactcgtacatcatgaaggagctgctggcctgc
tcgcaccccttctccaagagtgccaccgagcacgtccagggccacctggtgaagaagcag
gtgcctccggacctcttccagccctacatcgaagagatttgccaaaacctccgaggggat
gtgttccggaagttcatcgagagtgagaagttcacccgattctgccagtggaagaacgtg
gagctcaacatccacctgaccatgaacgacttcagcgtgcatcggatcatcgggcgcggg
ggcttcggcgaggtctacgggtgccggaaagccgacacgggcaagatgtacgccatgaag
tgcctggacaagaagcgcatcaagatgaagcagggcgagacgctggccctgaacgagcgc
atcatgctgtccctcgtcagcaccggggactgccccttcatcgtctgcatgtcctacgcc
ttccacacgcccgacaagctcagcttcatcctggacctcatgaacggcggggacctgcac
taccacctgtcccagcacggcgtcttctccgaggccgacatgcgcttctacgcggccgag
atcatcctgggcctggaacacatgcacaatcgcttcgtggtctaccgggacctgaagccc
gccaacatcctgctggacgaacacgggcacgtgcgcatctcggacctgggcctggcctgc
gacttctccaagaagaagccccacgccagcgtgggcacccacgggtacatggcccccgag
gtcctgcagaagggcgtggcctacgacagcagcgccgactggttctcgctgggctgcatg
ctcttcaagctgcttcgggggcacagccccttccggcagcacaagaccaaagacaagcat
gagatcgaccggatgacgttgacgatggccgtggagctgcccgactccttctccccggag
ctgcgctccctgctggaggggctgctgcagagggacgtgaaccggaggctgggctgcctg
ggccgcggggctcaggaggtgaaggagagccccttctttccgctccctggactggcagat
ggtcttcctgcagaagtaccctcccccgctgatccccccgcgcggggaggtgaacgcggc
cgacgccttcgacatcggctccttcgacgaggaggacacgaaagggatcaagttgctgga
cagcgaccaggagctctaccgcaacttccccctcaccatctcggagcggtggcagcagga
ggtggccgagacggtcttcgacaccatcaacgccgagaccgaccggctggaggcgcgcaa
gaaggccaagaacaagcagctgggccacgaggaagactacgccctgggcaaggactgcat
catgcatggctacatgtccaagatgggcaaccccttcctgacccagtggcagcggcggta
cttctacctgttccccaaccggctcgagtggcggggcgagggcgaggccccgcagagcct
gctgaccatggaggagatccagtcggtggaggagacgcagatcaaggagcgcaagtgcct
gctgctcaagatccgcgggggcaagcagttcgtgctgcagtgcgacagcgaccccgagct
ggtgcagtggaagaaggagcttcgcgacgcctaccgcgaggcgcagcagctggtgcagcg
ggtgccccggatgaagaacaagccgcgctcgcccgtggtggagctcagcaaggtgccgct
ggtgcagcgcagcagcgccaacggcctgtgagccgccccgccgccttttgtagacctcta
atttattttgtcggatttttattatttgttttcccgcaaagcggaaaaggttttattttg
taa

KEGG   Oryctolagus cuniculus (rabbit): 103351438
Entry
103351438         CDS       T03373                                 
Symbol
GRK5
Name
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103351438 (GRK5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351438 (GRK5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    103351438 (GRK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    103351438 (GRK5)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     103351438 (GRK5)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   103351438 (GRK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RGS Kinase-like Pkinase_fungal Sulfakinin
Other DBs
NCBI-GeneID: 103351438
NCBI-ProteinID: XP_008268823
LinkDB
Position
18:66434580..66630682
AA seq 590 aa
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEELRKTVDRDYCSLCDKQ
PIGRLLFRQFCETRPGLEGYIQFLDEVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQ
VGRDLVSQTEEQLLQRPCKELFSACARSVHDYLSGEPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEGRALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLDTEEAYSHKFSEEAKSIC
KMLLTKDAKQRLGCQEGGAAEVKKHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVSIPWQNEMIETECFKELNVFGPNGTPSPDLNRS
HAPEPPKKGLLHRIFRRQHQNNAKSSSNTKSSFNHHINSNHVSSNSTGSS
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagccagggaagggggagga
gggaagcgcaaagggaagagcaagaagtggaaggagatcctgaagttccctcacatcagc
cagtgcgaagaactgcggaagaccgtggacagagactactgcagtttatgtgacaagcag
ccaatcgggaggctgcttttccggcagttctgtgagaccaggcccgggctggagggttac
atccagttcctggacgaggtggcagaatatgaagttaccccggatgaaaagctgggagag
aaagggaaggagattatgaccaagtacctcacccccaagtccccagtcttcatcgcccaa
gttggccgagacctggtctcccagacggaagagcagctgctgcagaggccctgcaaagag
ctcttctcagcctgtgcacggtctgttcacgactacctgagcggagagccgttccacgag
tacctggacagcatgtacttcgaccgcttcctgcagtggaagtggctggaaaggcaacct
gtgaccaaaaatactttcaggcagtaccgagtacttggaaaagggggcttcggggaggtc
tgtgcctgccaggtccgggccacgggtaaaatgtatgcctgcaagcgcttggagaagaag
aggatcaagaagaggaaaggggagtccatggcactcaacgagaagcagatcctggagaag
gtcaacagccaattcgtggtcaacctggcctatgcctacgagaccaaggacgcactctgc
ttggtcctgaccatcatgaacgggggggacctcaagttccacatctacaatatggggaac
cccggcttcgaggaggggcgggccttgttctacgcagccgagatcctctgcggcctggaa
gacctgcaccgcgagaacaccgtgtacagagatctcaagcctgaaaacatcctgctggac
gattacggccacatcaggatctcagacctggggctggccgtgaagatccccgagggagac
ctgatccgcggccgagtgggcaccgtcggctacatggctccagaggtcctgaacaaccag
aggtacggcctgagccctgactactggggcctgggctgcctcatctacgagatgatcgag
ggccagtcgccgttccgcggccgcaaggagaaggtgaagcgggaggaagtggaccgccgg
gtcctggacaccgaggaggcctactcccacaagttctccgaggaagccaagtccatctgc
aagatgctgctgaccaaagatgcgaagcagaggctgggctgccaggaggggggtgccgcc
gaggtcaagaagcaccccttcttcaggaacatgaacttcaagcgcttagaagccgggatg
ttggaccctccctttgttccagatccccgggccgtctactgcaaggacgtgctggacatt
gagcagttctccaccgtgaagggcgtcaacctggaccacacagacgacgacttctactcc
aagttctccaccggctccgtgtccatcccgtggcaaaacgagatgatcgagaccgagtgc
tttaaggagctgaatgtgttcggacccaatggtaccccctcgccggacctgaaccgaagc
cacgccccggagccgcccaagaaggggctgctgcaccggatcttccggcggcagcaccag
aacaatgccaagagttcgtccaacaccaagagcagtttcaaccaccacataaattccaac
cacgtcagctcaaactccactggaagcagctag

DBGET integrated database retrieval system