KEGG   Oryctolagus cuniculus (rabbit): 100349863
Entry
100349863         CDS       T03373                                 
Symbol
CXCR3
Name
(RefSeq) C-X-C motif chemokine receptor 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100349863 (CXCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100349863 (CXCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100349863 (CXCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100349863 (CXCR3)
   04050 Cytokine receptors [BR:ocu04050]
    100349863 (CXCR3)
   04090 CD molecules [BR:ocu04090]
    100349863 (CXCR3)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100349863 (CXCR3)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   100349863 (CXCR3)
CD molecules [BR:ocu04090]
 Proteins
  100349863 (CXCR3)
SSDB
Motif
Pfam: 7tm_1 Ctr
Other DBs
NCBI-GeneID: 100349863
NCBI-ProteinID: XP_002720135
UniProt: A0A5F9CEX7
LinkDB
Position
X:complement(50077637..50080369)
AA seq 370 aa
MVSEVSGRQVLDASDFAMLLENCSSAYGDYGENESDSCCTSPPCPQDLSLNFDRAFLPAL
YSLLFLLGLLGNGAVAAVLLSQRAALSSTDTFLLHLAVADALLVMTLPLWAVDAAIQWVF
GSGLCKVAGALFNINFYAGALLLACISFDRYLSIVHATQLYRRGPRARVALTCVVVWGLC
LLFALPDFIFLSAHHDERLKATHCEYSFPQVGRTALRLLQLVAGFLLPLLVMAYCYARIL
AVLLLSRGQRRLRAMRLVVVVVVAFALCWTPYYLVVLVDTLMDLGALARHCGRESHVDVA
KSVTSGLGYMHCCLNPLLYAFVGIKFRERMWMLLVRLGCPGQRALQRQQPSSFRRDSSWS
ETTEASFSGL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggtctcggaggtgagcggacgccaggtgctggatgcctcagactttgccatgctcctg
gaaaactgtagctctgcgtacggagactacggagaaaacgagagcgactcctgctgcacc
tccccaccctgcccacaggacttgagcctgaacttcgaccgtgccttcctgccggccctc
tacagcctcctctttctgctggggctgctaggcaacggcgccgtggccgccgtgctgctg
agccagcgcgcggccctgagcagcaccgacaccttcctgctccacctggccgtggctgac
gccctgctggtgatgactctcccgctctgggcagtggacgctgccatccagtgggtcttt
ggctcgggcctctgcaaagtggctggcgccctcttcaacatcaacttctacgccggggcc
ctcctgctggcctgcatcagctttgaccgttacctgagcatagtgcacgccacgcagctc
taccgccggggcccccgggcccgtgtggccctcacctgtgtggtcgtgtgggggctctgt
ctgctctttgccctcccagacttcatcttcctgtcggctcaccacgacgagcggctcaaa
gccacccactgcgagtatagcttcccgcaggtgggccgcacggctctgcgcctcctgcag
ctggtggctggcttcctgctgcccctgctggttatggcctactgctatgcccgcatcctg
gctgtgctgctgctctccaggggccagaggcgcctgcgggccatgaggctggtggtggtg
gtagtggtggcctttgccctctgctggacgccctactacctggtggtgctggtggacacc
ctcatggacctgggggccttggcccgccactgcggccgagaaagccatgtggatgtggcc
aagtcggtcacctcaggcctgggctatatgcactgctgcctcaacccactgctctatgcc
tttgtgggcatcaagttccgagagcggatgtggatgctgttggtgcgcctgggctgccct
ggccagagagcactccaaaggcagcagccgtcctctttccgccgagactcgtcctggtcc
gagaccacagaggcctccttctcgggcctgtga

DBGET integrated database retrieval system