KEGG   Oryctolagus cuniculus (rabbit): 100350150
Entry
100350150         CDS       T03373                                 
Symbol
IL1RL1
Name
(RefSeq) interleukin 1 receptor like 1
  KO
K05171  interleukin 1 receptor-like 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100350150 (IL1RL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100350150 (IL1RL1)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL1 receptor family
   100350150 (IL1RL1)
SSDB
Motif
Pfam: TIR Ig_3 I-set ig Ig_6 Ig_2 TIR_2 V-set Izumo-Ig
Other DBs
NCBI-GeneID: 100350150
NCBI-ProteinID: XP_002709922
Ensembl: ENSOCUG00000016462
LinkDB
Position
2:complement(90078101..90113717)
AA seq 538 aa
MTPWILAFLTVPIYFTSAIDSEPSWGLENEALIVKCPNNVQSHYPVEWYHSTTNQRISTQ
KGNRVFASGELLKFLPAKVNDSGIYACIIRSPTLSNIRYANVTIYERQPDCRIPDDFIYS
TVHGSEKNAKIHCPKVEFYNWTAPLVWFKGCKALQGPRYMTHRAYLAIDNVTSDDAGDYT
CKLVHSENGVHYPVTATRSLIVKEKQGFSMFPVILAPPPNETKEVKIGETANLMCYACFG
KGPQFLVHVLWKVNGSNVRDFGDARIQEEEGPNESSSNEMTCRHKLLRITDVNETDLSLQ
FDCVALNHYVMKRHTTRLSRKKPINYQSTYHLVAGGSILLVLITVLVIILKVFWIEVILL
WRDTVRPYKTRNDGKLYDAYVIYPHDYQQSSEEISSVEYFVHQIMPNVLEDKCGYKLCIY
GRDLLPGEDAVTAVESSICKSRRHIFILSPVIVHSKEFAYEQEIALHSTLIQNDSKAILI
EMEALSEPDALQDSLKHLMEVQGTIKWREDNVANKWSLKSKFWKHVRYQMPVPHKLPR
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgacaccgtggatcttggcatttctaacagttcccatatatttcacatcagctatagat
agtgaaccatcttggggcctggaaaatgaggctttaattgtgaaatgtccaaataacgtg
caatctcattaccctgtggaatggtatcactcaacaacaaaccaaagaatttctacccag
aaaggaaatcgtgtatttgcctcaggggaacttcttaagttcctaccagcgaaagtcaac
gattctggaatttatgcttgcattatcagaagtcccaccctcagtaatattagatatgct
aatgtcaccatatatgaaagacaaccagattgcaggattccagatgatttcatatattca
acagtacatggatcagaaaaaaatgccaaaatacattgtcctaaagttgaattctacaat
tggacagcacctcttgtgtggtttaagggttgtaaggccctgcaaggaccaagatacatg
acacacagggcgtatttggccatcgacaacgtgacaagtgatgatgcaggggattacaca
tgtaaattagtacacagtgaaaatggagtccattaccctgtgacagcaaccagatctttg
atagtcaaagagaagcaaggcttttccatgttcccagtaattttagctcctccaccaaat
gaaacaaaagaagtcaaaataggggaaacagcaaacctaatgtgctacgcttgctttgga
aaaggccctcagttccttgttcacgtcctgtggaaagttaatggaagtaacgtaagagac
tttggtgatgcaagaatccaagaggaggaaggacccaatgaaagttctagcaatgaaatg
acttgtcgccacaaactcttaaggataactgacgtgaatgagacggatttatctctgcag
ttcgactgtgtggccctgaatcattatgttatgaaaaggcacaccacgagactaagtcgg
aaaaagccaattaattatcagagcacctaccacctagttgctggaggtagtatattgtta
gtgttaatcactgtcttggtgatcatcctaaaagtgttctggattgaggtgattctgctc
tggagagacacagttcgaccttacaaaactaggaatgatggaaagctctatgatgcttat
gttatatatccacacgattaccaacagagttcagaggagatcagttctgtggaatatttt
gttcatcagattatgcccaatgtccttgaagataagtgtggatataaattatgcatttat
gggagagatctgctacctggagaagatgcggtcaccgcggtggaatccagcatatgcaag
agcaggcggcacattttcatcctgtctcctgtcatcgtgcacagcaaagagtttgcctat
gagcaggagatcgccctgcacagcaccctcatccagaatgactccaaggcgatcctgatt
gagatggaggctctgagcgagccagacgctctgcaggattctctcaagcacctgatggaa
gtgcagggcaccatcaagtggagggaagacaatgttgccaacaaatggtccctgaagtcc
aagttctggaagcacgtgagataccaaatgcctgtgccgcacaaactgcccagatag

DBGET integrated database retrieval system