KEGG   Oryctolagus cuniculus (rabbit): 100350969
Entry
100350969         CDS       T03373                                 
Symbol
RAB22A
Name
(RefSeq) RAB22A, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350969 (RAB22A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350969 (RAB22A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100350969 (RAB22A)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100350969 (RAB22A)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100350969 (RAB22A)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 Gtr1_RagA RsgA_GTPase GTP_EFTU AAA_7 AAA_16 NTPase_1
Other DBs
NCBI-GeneID: 100350969
NCBI-ProteinID: XP_002723671
Ensembl: ENSOCUG00000004414
LinkDB
Position
Un
AA seq 282 aa
MGVAGSRPRRRRRRPGGPGGVPATKAGSARLAADGPGRGPADRRPLSPRAPRPGLGRVAA
APGNAFAGPGLSFLNLGRRRARAPGSRAMALRELKVCLLGDTGVGKSSIVWRFVEDSFDP
NINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEET
FSTLKNWVKELRQHGPPNIVVAIAGNKCDLIDVREVMERDAKDYADSIHAIFVETSAKNA
ININELFIEISRRIPSGDTSQPSGSKGFKLRRQPSEPRRSCC
NT seq 849 nt   +upstreamnt  +downstreamnt
atgggggtggcgggctccagacctcggcggcggcggcggcggccgggaggccctggcggc
gtcccggccactaaggcgggctctgcgcggctggcggcggacgggccgggccgagggccg
gcggacaggcggccgctgtccccccgcgctccgcggccggggctgggccgtgtggcggcg
gcgccggggaatgcttttgctgggcccggcctctccttcctcaacttagggcggcggcgg
gcccgcgcccctgggtcccgggccatggcgctgcgggagctcaaagtgtgtctgctgggg
gatacgggtgtaggtaaatccagcatcgtctggcggtttgtggaagacagctttgatccg
aacatcaacccaaccataggggcatcttttatgaccaagactgtccagtaccaaaatgag
ctccataaattcctaatctgggatacagcgggacaagaacgattccgtgccttagcacca
atgtactatcgtgggtcggctgcagccatcatcgtctatgacattacaaaagaagagaca
ttctccacgttaaagaactgggtaaaggagcttcgacagcacgggccgcccaatattgtg
gttgccattgcaggaaataagtgtgatcttatcgatgtcagagaagtcatggagagagat
gctaaggactatgccgactccattcatgcaatttttgtagagaccagcgcaaaaaacgcg
ataaacataaatgaactctttatagaaattagtcgaagaattccctccggggacaccagc
cagccctctggcagtaagggcttcaaactccggaggcagccttcagagccaaggcggagc
tgctgctga

KEGG   Oryctolagus cuniculus (rabbit): 100353778
Entry
100353778         CDS       T03373                                 
Symbol
RAB31
Name
(RefSeq) RAB31, member RAS oncogene family
  KO
K07891  Ras-related protein Rab-22
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100353778 (RAB31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100353778 (RAB31)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    100353778 (RAB31)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab GTPases
    100353778 (RAB31)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab5/17/22/31 [OT]
    100353778 (RAB31)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 GTP_EFTU Gtr1_RagA TniB AAA_7 FeoB_N NACHT AAA_5 AAA_16
Other DBs
NCBI-GeneID: 100353778
NCBI-ProteinID: XP_008259257
Ensembl: ENSOCUG00000008604
UniProt: G1SVH8
LinkDB
Position
9:complement(51982629..52122872)
AA seq 195 aa
MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIW
DTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNK
CDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGTGGA
IKLGKHTSQPGRRCC
NT seq 588 nt   +upstreamnt  +downstreamnt
atgatggcgatacgcgagctcaaagtgtgccttctcggggacactggggttgggaaatcg
agcatcgtgtgtcgctttgtgcaggatcactttgaccacaacatcagccctaccatcggg
gcgtcttttatgaccaaaactgtgccttgtggaaatgaacttcacaaattcctcatctgg
gacacggctggtcaggagcggttccactccttggcccccatgtactaccggggatctgcc
gcagctgtcatcgtgtatgacatcaccaagcaggattcctttcataccttgaagaaatgg
gtgaaggaactgaaagaacatggtcctgaaaatattgtgatggccattgctggaaacaaa
tgtgatctgtcagatatcagggaggttcctctgaaggatgcaaaggaatatgctgagtcc
ataggtgccatcgtggttgaaacaagtgcgaagaacgctatcaacatcgaagagctcttt
caaggaatcagccgccagatcccacccttggacccccacgagaatggaaccggcggggcc
atcaagctcgggaagcatacttcgcagcccggccgcaggtgctgctga

DBGET integrated database retrieval system