KEGG   Oryctolagus cuniculus (rabbit): 100350994
Entry
100350994         CDS       T03373                                 
Symbol
WIPF1
Name
(RefSeq) WAS/WASL interacting protein family member 1
  KO
K19475  WAS/WASL-interacting protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350994 (WIPF1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100350994 (WIPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350994 (WIPF1)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100350994 (WIPF1)
SSDB
Motif
Pfam: WH2 GRP
Other DBs
NCBI-GeneID: 100350994
NCBI-ProteinID: XP_002712344
Ensembl: ENSOCUG00000005696
UniProt: G1SPG7
LinkDB
Position
7:complement(114201336..114330377)
AA seq 502 aa
MPVPPPPAPPPPPTFALANTEKPTLNKREQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGASAGGGGGFGGGGGGGGGGGGGGSGGGAGGPPGLGGLFQAGMPKLRSTASRDNDSG
GSRPPILPPGGRATSAKPFSPPSGPGRFPGPSPAGHRSGPPEPQRVRMLPPRPDVGSKPD
SVPPPVPNTPRPIQSSLHNRGSPPVPGAPRPPGPGPAPPPFPGNRGAAFGGGSVRQSPSG
SPSPFANRPPLPPTPSRALDDKPPPPPPPVGNRPSIHREVVPPPPPQNNKPPVPSSPRPA
ASSQAPPPPPPPSRPGPPPLPPGGGGGDEIPRLPQRNVSLTSAAPPLPSVGRSGPLPPPP
SERPPPPVRDPPGRSGPLPPPPPVSRNGSTSRALPATPQLPSRSGVDSPRSGPRPPLPPD
RPGAGAPPPPPPSTSIRNGFQDSSCEDEWESRFFFHPISDLPPPEPYVPTAKSYPSKLAR
NESRSGSNRRERGAPPLPPIPR
NT seq 1509 nt   +upstreamnt  +downstreamnt
atgcccgtccctccgcctccggcacccccaccgccaccaacatttgccctggccaatacc
gagaagcctaccctgaataagagagagcaggctgggagaaatgctctgctctctgacatc
agcaaagggaagaaactgaagaagacagtcaccaatgacagaagtgcaccgatactggac
aaacctaaaggagccagtgctggaggaggcggtggatttggtggaggtggcggcggcggt
ggtggtggaggcggaggtggcagtggcggcggagcgggtggcccgcctggattgggagga
ctgttccaggctggaatgccgaagctgaggtccacagccagcagggataatgattccgga
ggaagccgaccaccgattttgccaccaggaggaagagccacctctgccaagcctttttca
cccccaagtggcccggggaggtttcccgggccttctccggcaggccacaggagcggtccc
ccagagcctcagagggtccgaatgcttcccccgaggcctgacgtaggctcgaagcccgat
agtgttcctcctccagtacctaacacgccaagacctattcagtcaagtctgcacaaccgg
gggtccccaccagtgcctggggcgcccaggccacctggccccggccctgctccgccgcct
ttccctgggaaccgaggtgctgccttcggaggaggctccgtacgtcagtcaccctcgggc
tccccctcgcccttcgccaacaggcctcccctgcctcccacccccagcagggccttggat
gacaagccccctccaccgcccccgccagtgggcaacaggccctccatccacagggaagtg
gtgccaccgcctccgccgcagaacaacaagcctccagtgccttccagcccgcggcctgcc
gcctcctcacaggccccgcccccaccgccgccacccagcaggcccgggccgccccccctg
ccgccaggtggcggcggcggtgacgaaatcccaaggctcccgcagcggaatgtgtccctc
acgtccgctgcacctcccttaccgtcagtgggacgttcgggccctcttcctcccccgccc
agcgagagaccccctcctccagtgagggacccgccaggcagatcaggccccctcccccca
ccacctccagtaagcagaaatggcagcacatcgcgggccctgcctgccacccctcagctg
ccatccaggagtggagttgacagccccaggagtggcccccggcctccacttccccccgac
aggcctggtgctggggcccctccgccgcctccaccatcaacatcaattagaaatggcttc
caagattcttcatgtgaagatgagtgggaaagcagattcttcttccacccaatttctgat
ttgccacctccagagccatatgtaccaacagccaaaagttaccccagtaaactggcaaga
aacgagagccgcagtggctccaaccgaagagaacggggtgccccaccacttcctcccatc
ccaaggtga

KEGG   Oryctolagus cuniculus (rabbit): 100358527
Entry
100358527         CDS       T03373                                 
Symbol
WIPF3
Name
(RefSeq) WAS/WASL interacting protein family member 3
  KO
K19475  WAS/WASL-interacting protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358527 (WIPF3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100358527 (WIPF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358527 (WIPF3)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100358527 (WIPF3)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 100358527
NCBI-ProteinID: XP_017199848
LinkDB
Position
10:14278850..14342559
AA seq 441 aa
MPVPPPPPPPLPPPPPPLGAPPPPPSAPLISSDAAGLRKADPRGRSALLADIQQGTRLRK
VTQINDRSAPQIESPKGTNKEGGVAANSRGGSTPPALGDLFAGGFPVLRPAGQRDAAGGK
AGQAPGSRAPSPRLPIKTISGPLNPPASPRLGIASEAHGTARTVPPRPPPVPAPLFKICL
RDRTPNPCAPPPPPPPPPPLPPTSGPSDKTVKPQLAPLPLPPLPPPLPLLPPCGYPGLHP
EPASPAQDAREPAGPPPPPPLYAVCSPRAPAPTPPPLPGANRGNETPPPLPPKSPGCPSP
LPKAGATPGSQPFLQKKRPGRGPGVGGGKLNPPPAPPARSPTTELSSKSQQQAPAWTPTP
QPGGQLRNGSLPVLDDFESKFTFHSVEDFPPPDEYKASQKVYPSKIPRSRTPGPWLPAEA
AAQGSDDIKGRNSQLSLKTLR
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgccagtgccaccgccgccaccacctcctttgcctccacctcctccacccctgggggct
cctcctcccccaccgtctgcacccctgatcagctcagatgctgctggcttgagaaaggca
gacccgcgaggtcggagcgcgctgctggctgacatccaacaagggactcgcctgcggaag
gtcacgcaaatcaacgaccgaagtgctccacagatcgagagccctaaaggaaccaacaag
gagggaggagttgctgcgaactcccgcggcggcagcacacccccggctctgggagacctg
tttgctgggggctttcctgtgttgcgaccggcaggccagagggatgcggcaggtggcaag
gcggggcaggcccctggctcccgggcaccatctcccaggctgcccatcaaaaccatcagc
ggcccgctcaaccccccagcctcccccaggctcggcatcgcctctgaggcgcacggcact
gccaggacagtccctcctcgccccccacccgtgcccgccccgttgttcaaaatttgtctc
agagatcgcacccccaacccctgcgcgcctccacccccgcctcctcccccgcccccgcta
cccccaacctctgggcccagtgacaagaccgtgaagcctcagctcgcccctctgcccctg
ccacccctaccgcccccgctccctctcctcccaccttgtgggtatccgggtctccaccca
gagcctgccagccccgcccaggatgcgcgggaacctgcggggccaccgcccccgccgccc
ctgtatgccgtgtgctcaccgagggcacctgcacccactccgccccctctgccaggcgca
aatcgcggcaacgaaaccccacccccgctgccccccaagtcccccggctgccccagcccg
ttgccaaaggccggcgcaactccgggctcgcagcccttcctgcagaagaagaggcccggc
cggggcccaggggtcggtggggggaagctgaacccgcctccggcaccccctgcgaggtcc
cccaccacggagctttcgagcaagagccagcagcaggccccagcctggaccccgaccccg
cagcccggagggcagctacgaaacgggagcctgcccgtcctcgacgacttcgagtccaag
ttcaccttccattctgtggaggactttccccctccggatgagtacaaagcaagccagaag
gtctaccccagcaagatcccccgaagccgcacacctggtccctggctcccggccgaggca
gccgcgcagggctccgacgacatcaaaggcagaaactctcagctctcgctaaagacactg
cggtga

KEGG   Oryctolagus cuniculus (rabbit): 100358641
Entry
100358641         CDS       T03373                                 
Symbol
WIPF2
Name
(RefSeq) WAS/WASL interacting protein family member 2
  KO
K19475  WAS/WASL-interacting protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358641 (WIPF2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100358641 (WIPF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358641 (WIPF2)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100358641 (WIPF2)
SSDB
Motif
Pfam: WH2
Other DBs
NCBI-GeneID: 100358641
NCBI-ProteinID: XP_002719399
UniProt: G1SQU4
LinkDB
Position
19:41392456..41449587
AA seq 439 aa
MPIPPPPPPPPGPPPPPTFNQANTEPPKLSRDEQRGRGALLQDICKGTKLKKVTNVNDRS
APILEKPKGSSGGYGCGAAALQPKGGLFQGGVPKLRPVGAKDASENPAGKPALQVPSSRA
AAPRPPVSTASGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPMHSNKAPAYNREKPLPPTPGQRLHPGREGPPAPPPVKPPPSPVNIR
TGPSSQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SASPSLLSNRPPPPARDPPSRGAAPPPPPPMIRNGARDAPPPPPPYRMHGSEPLSRGKPP
PPPSRTPAGPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRIY
PSKTNRAARGAPPLPPILR
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgccaattcctcctccccctccacccccacctggtcctcctccacctcccacttttaat
caggccaacacagagccgcccaagctgagtagagatgagcagcgaggtcgaggtgccctc
ttacaggacatatgcaaagggaccaagctgaagaaggtgaccaacgttaatgaccggagt
gctcccatcctggagaagcccaaagggagcagtgggggttatggctgtggagcagctgcc
ttgcagcccaaaggaggacttttccaaggaggagtgcccaagctcagacctgtgggagcc
aaggatgcttcagagaatccagctggtaagccagctctacaagtccccagttctcgagct
gccgcccccaggcctccagtgtctacagccagcgggcgtcctcaggatgatacagacagc
agtcgagcctcactcccagaactgccgcggatgcagagaccctctttgccagacctctct
cggcctaataccaccagcagtactggcatgaagcacagctcctctgccccacctccgccc
cccccagggcggcgtgccaatgcaccccctacacctctgcctatgcacagcaacaaagcc
ccagcctacaacagagagaaacccttgccgccaacacctggacagaggcttcatcctggc
cgagaaggacctcctgctcctcccccagtcaaaccacctccttcccctgtgaatatcaga
acgggaccaagtagccagtctctggctcctcctccaccgccttaccgccagcctcctggg
gtccccaatggaccctccagtcccactaatgagtcagcccctgagcttccacagagacac
aattctttgcataggaagacaccagggcctgtcagaggcctggcacctcctccacccacc
tcagcctctccctctttactgagtaataggccacctcccccagcgcgagaccctcccagt
cggggagcagctcctccacccccaccacccatgatccgaaatggtgccagggatgctccg
cctccccccccaccataccgaatgcatgggtcagagcccctgagccgaggaaagccccca
cctccgccttcaaggacaccagctgggccaccccctcctccaccacctctaaggaatggc
cacagagattccatcaccactgtccggtctttcttggatgattttgaatcaaagtattcc
ttccatccagtagaggattttcctgctccagaagaatataaacactttcagagaatatac
cccagcaaaacaaatcgagctgcccgtggagccccacctctgccacccattctcaggtga

DBGET integrated database retrieval system