KEGG   Oryctolagus cuniculus (rabbit): 100351102
Entry
100351102         CDS       T03373                                 
Symbol
CUL4B
Name
(RefSeq) cullin 4B
  KO
K10609  cullin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03420  Nucleotide excision repair
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100351102 (CUL4B)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100351102 (CUL4B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100351102 (CUL4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100351102 (CUL4B)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100351102 (CUL4B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100351102 (CUL4B)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     100351102 (CUL4B)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100351102 (CUL4B)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100351102 (CUL4B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100351102 (CUL4B)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW
Other DBs
NCBI-GeneID: 100351102
NCBI-ProteinID: XP_002720454
Ensembl: ENSOCUG00000015633
LinkDB
Position
X:complement(94958449..95028958)
AA seq 910 aa
MSHLSESGERSDDEVIEDDDGFSSPNPSAAAAAQEVRSATDGNTSTTPPTSAKKRKLNSS
SSSGSNSSNEREDFDSTSSSSSTPPLQPRDSASPSTSSFCLGVSVATSSHVPIQKKLRFE
DTLEFVGFDAKMAEESSSSSSSSSPTAATSQQQQLKNKSILISSVASVHHANGLAKSTTV
SSFANSKPGSAKKLVIKNFKDKPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQA
VENLCSYKISANLYKQLRQICEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMI
RSIFLFLDRTYVLQNSMLPSIWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNGEAI
DRSLLRSLLSMLSDLQIYQDSFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKRLEE
EADRLITYLDQTTQKSLIATVEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRV
RGGVQVLLQQWIEYIKAFGSTIVINPEKDKTMVQELLDFKDKVDHIIDICFLKNEKFINA
MKEAFETFINKRPNKPAELIAKYVDSKLRAGNKEATDEELEKMLDKIMIIFRFIYGKDVF
EAFYKKDLAKRLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMIQFK
QYMQNQNVPGNIELTVNILTMGYWPTYVPMEVHLPPEMVKLQEIFKTFYLGKHSGRKLQW
QSTLGHCVLKAEFKEGKKELQVSLFQTLVLLMFNEGEEFSLEEIKQATGIEDGELRRTLQ
SLACGKARVLAKNPKGKDIEDGDKFICNDDFKHKLFRIKINQIQMKETVEEQASTTERVF
QDRQYQIDAAIVRIMKMRKTLSHNLLVSEVYNQLKFPVKPADLKKRIESLIDRDYMERDK
ENPNQYNYIA
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgtcacacttatctgaatcaggggaaaggagtgatgatgaggtcatagaagatgatgat
ggtttttcttcccccaatccctcagctgctgctgctgctcaggaggtcagatctgccact
gatggtaataccagcaccactccgcccacctctgccaagaagagaaagttaaacagcagc
agcagtagcggcagtaacagtagtaacgagagagaagactttgattccacctcttcctcc
tcttccactcctcctttacaacccagggattcggcatccccttcaacctcgtccttctgc
ctgggggtttcggtggctacttccagccacgtaccgatacagaagaagctgcgttttgaa
gacaccctggagtttgtagggtttgatgcgaagatggccgaggaatcctcctcctcctcc
tcctcatcttcaccaactgctgcaacatctcagcagcagcaacttaaaaataagagtata
ttaatctcttctgtggcttcggtgcatcatgcaaacggcctagccaaatctaccaccgtc
tctagctttgctaacagcaagcctggctctgctaagaagttagtgatcaagaactttaaa
gataagcctaaattaccagaaaactacacagatgaaacttggcagaaactgaaagaagca
gtggaagctattcagaatagtacttcaattaagtacaatttagaagaactctaccaggct
gtagaaaatctctgttcttacaagatttctgcaaacttgtacaaacagctgagacagatt
tgtgaagatcacatcaaagcacaaattcatcagttcagagaggattcattggatagtgtt
cttttcctaaaaaagattgatagatgctggcagaaccattgcagacaaatgatcatgatc
aggagcatctttttgtttctggatagaacttacgttcttcagaattcaatgctgccctcc
atttgggacatgggactggagttatttagagcacatattataagtgatcagaaagtccag
aataagacaattgatggcattcttctcttgattgagagggaaaggaatggcgaagcaatt
gatagaagtttactccgaagccttttaagtatgctctctgatttacaaatttatcaagat
tcttttgaacaacgatttttggaagaaactaaccgactctatgcagctgaaggccaaaaa
ttaatgcaagaaagagaggttcctgaatatcttcatcatgttaacaaacgtctagaagaa
gaagcagacagacttattacgtatttagatcagactacacagaaatcattaattgctact
gtagaaaaacaacttctaggggaacacttaacagcaattcttcagaaaggtttaaataac
ctccttgatgaaaaccgaattcaagatttgtctctcctgtatcagctcttcagtagagtt
cgaggtggcgttcaggttctcttgcaacaatggattgagtacatcaaggcatttggcagc
actattgtaattaatcctgaaaaagataaaaccatggttcaagaattgctagattttaaa
gataaggttgatcatataatcgatatctgctttctgaagaatgaaaagtttattaatgcc
atgaaagaagcatttgaaacattcattaacaagagaccaaataaacctgctgaacttata
gccaagtatgtagattcaaagcttcgtgcaggcaacaaagaagctacagatgaagaactt
gagaaaatgttggataaaattatgatcatatttagatttatctatggcaaggatgttttt
gaggccttctataagaaagatttagccaagcgtctgttagttgggaagagtgcatctgta
gatgctgaaaaatcaatgttgtccaaactcaaacatgaatgtggagctgctttcaccagc
aagcttgaagggatgtttaaagacatggagctttctaaagacatcatgattcagttcaaa
cagtatatgcagaaccagaatgtacctggaaatattgaattaactgtgaatatcctgaca
atgggttattggccaacgtatgtacctatggaagtccatttaccaccagagatggtaaag
cttcaggagatttttaagacattttacctaggtaaacacagtggcaggaaacttcagtgg
cagtcaaccctaggacactgtgtgctaaaagcagagtttaaagagggcaaaaaagaactc
caggtctctctttttcaaacactggtgctgctaatgtttaatgagggagaggagttcagt
ttagaagagatcaaacaggctactggaatcgaggatggagagttaaggagaacattgcag
tcattagcctgtggaaaagctagagttctggcgaaaaatccaaagggcaaagatatagaa
gatggtgacaagttcatttgtaatgatgatttcaaacacaaacttttcaggataaagatc
aatcaaatccagatgaaagagacggttgaggaacaagcaagtactacagaaagagtattt
caagacagacaatatcaaattgatgctgcaattgttcgaattatgaagatgagaaagaca
cttagtcacaatttgcttgtttcagaagtgtacaaccaattgaaattcccagtaaagcct
gctgatcttaagaagagaatagaatccttaattgaccgggactacatggaaagagataaa
gaaaatccaaaccagtacaactatattgcatag

KEGG   Oryctolagus cuniculus (rabbit): 100354247
Entry
100354247         CDS       T03373                                 
Symbol
CUL4A
Name
(RefSeq) cullin 4A
  KO
K10609  cullin 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03420  Nucleotide excision repair
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100354247 (CUL4A)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100354247 (CUL4A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100354247 (CUL4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100354247 (CUL4A)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100354247 (CUL4A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100354247 (CUL4A)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Cullin
     100354247 (CUL4A)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100354247 (CUL4A)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100354247 (CUL4A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100354247 (CUL4A)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8 SecA_SW PTPS
Other DBs
NCBI-GeneID: 100354247
NCBI-ProteinID: XP_002723510
Ensembl: ENSOCUG00000009610
UniProt: G1SXJ6
LinkDB
Position
Un
AA seq 759 aa
MADEAPRKAGVSALVGRTNGLTKPAGLAGGPNKPGGAGGSRKLVIKNFRDRPQLPDNYTQ
DTWRQLHEAVRAIQGSTSIRYNLEELYQAVENLCSHKVSPTLYKQLRQVCEDHVQAQILQ
FREDSLDSVLFLKKIDTCWQDHCRQMIMIRSIFLFLDRTYVLQNSMLPSLWDMGLELFRN
HIISDRMVQSKTIDGILLLIERERSGEAVDRSLLRSLLSMLSDLQVYKDSFELRFLEETN
CLYAAEGQRLMQEREVPEYLNHVSKRLEEEGDRVITYLDHSTQKPLIACVEKQLLGEHLT
AILQKGLDHLLDENRVPDLTQMYQLFSRVKGGQQALLQHWSEYIKTFGTTIVINPEKDKD
MVQDLLDFKDRVDHVIEVCFQKNERFINLMKESFETFINKRPNKPAELIAKHVDSKLRAG
NKEATDEELERILDKIMIMFRFIHGKDVFEAFYKKDLAKRLLVGKSASVDAEKSMLSKLK
HECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDPGPIDLTVNILTMGYWPTYTPME
VHLTPEMVKLQEVFKTFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLL
MFNEGDGFSFEEIKMATGIEESELRRTLQSLACGNARVLLKSPKGKEVEDGDKFLFNADF
KHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELY
NQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA
NT seq 2280 nt   +upstreamnt  +downstreamnt
atggcggacgaggccccgcgcaaggccggcgtctcggccctcgtgggccgcaccaacggc
ctcaccaagcccgcgggcctggccggcggccccaacaagccgggcggcgcgggcggctcc
aggaagctggtcatcaagaatttccgagacaggccgcagctgcccgacaactacacgcag
gacacgtggcgccagctgcacgaggccgtgcgggccatccagggcagcacctccatccgc
tacaacctggaggagctgtaccaggctgttgagaacctctgctctcacaaggtctccccg
acactgtacaagcagctgcgccaggtctgtgaggaccacgtccaagcacaaattctccag
ttcagagaagactcgctagacagcgttttatttttaaagaagattgacacgtgctggcaa
gatcactgcagacagatgatcatgatcaggagcatcttcctgtttctggaccgcacctac
gtcctgcagaactccatgctcccgtctctctgggacatgggattagaactgttccgaaac
cacattattagtgacaggatggttcagagcaagaccatcgatggcattctgctcttaatc
gaacgagagcgaagcggggaggccgtggaccggagcctgctgcggagcctgctgagcatg
ctgtccgacctgcaggtgtataaggactcatttgaactgagatttttggaagagacgaat
tgtttatatgctgcagaaggccaaagattgatgcaagaaagagaggttccagaatatctt
aaccatgtaagtaaacgtctggaagaggaaggagatcgcgtgatcacgtacttagaccac
agcacccagaaaccactgattgcttgtgtggagaagcagctgctgggggagcacctgaca
gcaattctgcagaaaggtctcgaccacctgctggatgagaacagagtgccggacctcacg
cagatgtaccagctgttcagccgcgtgaagggcggccagcaggcgctgctgcagcactgg
agcgagtacatcaagacgtttggaaccacgattgtcatcaatcctgagaaggataaagac
atggtgcaggatctgctggacttcaaggacagggtggaccatgtgatcgaggtgtgcttc
cagaagaacgagcggttcatcaacctgatgaaggagtccttcgagacgttcatcaacaag
agacccaataagcctgcagagctgatcgccaagcacgttgattcaaagctgagagcaggc
aacaaggaagccacagatgaggagctggagcgcatcctggacaagatcatgatcatgttc
aggttcattcacggcaaagacgtctttgaagcgttttataaaaaggatttggcaaaaaga
ctcctggttggaaaaagtgcctcagtggacgccgagaagtcgatgctgtccaagctgaag
catgagtgcggggctgcgttcaccagcaagctggaaggcatgttcaaggacatggagctc
tccaaggacatcatggtgcacttcaagcagcacatgcagaatcagagtgacccaggcccc
atcgacctcaccgtgaacatcctcacgatgggctactggccgacgtacacgcccatggag
gtgcatctgacgccagaaatggttaaacttcaggaagtgtttaagaccttctacctcggg
aagcacagcggccggaaacttcagtggcagacgactttgggacatgctgttctgaaagcg
gagtttaaggaaggcaagaaggagttccaggtgtccctgttccagacgctcgtgctgctc
atgttcaacgagggcgacgggttcagcttcgaggagatcaagatggccaccggcatagag
gagagcgagctgcggcggacgctgcagtcgctggcgtgcgggaatgcgcgggtgctgctg
aagagccccaaggggaaggaggtggaggacggggacaagttcctcttcaacgcagacttc
aagcacaagctgttcaggataaagatcaaccagatccagatgaaggagaccgttgaggaa
caggttagcaccactgagcgggtgtttcaggatcgacagtatcagatcgatgctgccatc
gtcagaataatgaagatgaggaagacgctgggtcacaatctcctggtttctgagttgtat
aatcagctgaagtttccggtcaagcctggcgatttgaagaagagaatcgaatctcttata
gacagagactacatggagagagacaaagacaatcccaaccagtaccactatgtggcgtga

DBGET integrated database retrieval system