KEGG   Oryctolagus cuniculus (rabbit): 100351135
Entry
100351135         CDS       T03373                                 
Symbol
DPYSL2
Name
(RefSeq) dihydropyrimidinase like 2
  KO
K07528  dihydropyrimidinase-like 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100351135 (DPYSL2)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3
Other DBs
NCBI-GeneID: 100351135
NCBI-ProteinID: XP_002709501
Ensembl: ENSOCUG00000016002
UniProt: G1U974
LinkDB
Position
2:complement(43044836..43119606)
AA seq 572 aa
MSYQGKKNIPRITSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEA
HSRMVIPGGIDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAF
DQWREWADSKSCCDYSLHVDITEWHKGIQEEMEALVKDHGVNSFLVYMAFKDRFQLTDSQ
IYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRSI
TIANQTNCPLYITKVMSKSAAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAA
FVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEE
RMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIWDPDSIKTI
SAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYK
RIKARSRLAELRGVPRGLYDGPVCEVSVTPKTVTPASSAKTSPAKQQAPPVRNLHQSGFS
LSGAQIDDNIPRRTTQRIVAPPGGRANITSLG
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgtcttaccaggggaagaagaatattccacgcatcacgagtgatcgtcttctgatcaaa
ggaggtaaaattgttaacgatgaccagtccttctatgcagacatatacatggaagatggg
ttgatcaagcaaataggagaaaacctgattgtgccaggaggggtgaagaccatcgaagcc
cattccaggatggtgatcccgggaggaatcgacgtgcacactcggttccagatgcccgac
caaggaatgacatctgccgatgacttcttccaagggactaaggcagccctggctgggggg
accaccatgatcatcgaccacgtggttcccgagcccgggaccagcctgctggctgccttc
gaccagtggagggaatgggccgacagcaagtcttgctgcgactactccctgcacgtggac
atcactgagtggcacaagggcatccaggaggagatggaagccctggtgaaggaccacggg
gtaaattccttccttgtgtacatggctttcaaagatcgctttcagctaaccgactcccag
atatatgaggtcctgagtgtgatccgggatatcggtgccatcgcccaagtccacgcggaa
aatggtgacatcatcgcagaggagcagcagaggatcctggatctgggcatcaccggccct
gaaggacacgtgctcagccggccagaggaggtggaggctgaagcggtgaaccgttccatc
accattgccaaccagaccaactgccccctgtacatcaccaaggtgatgagcaagagtgct
gctgaagtcatcgcccaggcccggaaaaagggaaccgtggtgtatggcgagcccatcacc
gccagcttgggaactgatggctcccactactggagcaagaactgggccaaggctgctgcc
tttgtcacttccccgcccctgagcccagatccaaccactccagactttctcaactccttg
ctgtcctgtggcgacctccaggtcactggcagtgcccactgtactttcaacactgcccag
aaggctgtaggaaaggacaacttcacgctgattcccgaggggaccaacggcactgaggag
cggatgtccgtcatctgggataaggctgtggtcactgggaaaatggatgagaaccagttc
gtggctgtgaccagcaccaatgcagccaaagtcttcaacctttaccctcggaaaggccgc
attgctgtgggatccgacgcagacctggtcatctgggaccccgacagcattaaaaccatc
tctgccaagacacacaacagttctctggagtacaacatcttcgaaggcatggagtgccgc
ggctctccgctggtggtcatcagccaggggaagatcgtcctggaggacggcacgcttcac
gtcaccgaaggctctgggcgctacatcccccggaagcccttccctgactttgtttacaag
cgtatcaaggccaggagcaggctggcggagctaagaggcgtgccccgcggcctgtacgac
ggacccgtgtgcgaggtgtccgtgacgcccaagacggtcactcccgcctcctcggccaag
acgtcgcccgccaagcagcaggccccgcctgtccgcaacctgcaccagtctggattcagc
ttgtccggcgcacagatcgatgacaacattccccgccgcaccacccagcgcatcgtggcg
ccccccggcggccgtgccaacatcaccagcctgggctag

DBGET integrated database retrieval system