KEGG   Oryctolagus cuniculus (rabbit): 100351345
Entry
100351345         CDS       T03373                                 
Symbol
EGR2
Name
(RefSeq) early growth response 2
  KO
K12496  early growth response protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04625  C-type lectin receptor signaling pathway
ocu05161  Hepatitis B
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100351345 (EGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100351345 (EGR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100351345 (EGR2)
   05161 Hepatitis B
    100351345 (EGR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100351345 (EGR2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100351345 (EGR2)
SSDB
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5 zf-RING_15
Other DBs
NCBI-GeneID: 100351345
NCBI-ProteinID: XP_008268305
Ensembl: ENSOCUG00000013672
LinkDB
Position
18:23380794..23387584
AA seq 425 aa
MNGVAGDGMINIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPE
GIINIVSAGILQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPP
PPPPYSGCAGDLYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPSLFPMIPDYPGF
FPPQCQRDLHGTAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPSAGVTGPGAGGGN
EGPRLPGSSSAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRF
SRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSD
ERKRHTKIHLRQKERKSSAPSSSVPAPSAAPCAGGTQAGAALCGSNSSTIGGGPLAPCSS
RTRTP
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaacggagttgccggagatggcatgatcaacattgacatgacaggagagaagaggtct
ttggatctcccatatcccagcagctttgctccggtctccgcgcccagaaaccagaccttt
acttacatgggcaagttctccattgacccccaataccctggtgccagctgctacccagaa
ggcatcatcaatatagtgagcgcaggcattctgcaaggggtcacttccccagcttcaacc
acagcttcgtccagcgtcacctctgcctctcccaacccactggccacaggacccctgggt
gtgtgcaccatgtcgcagacacagcctgacctggaccacctctactcgccgccaccaccg
ccgccgccaccgtactctggctgtgcaggagacctgtaccaggacccctctgcgttcctg
tcggcagccaccacctccacctcctcctctctggcctacccaccgcctccttcttacccg
tcccccaagccggccacggaccccagtctcttccctatgatcccagactatcctggattt
ttcccgcctcagtgccagagggacctccatggcaccgctggcccagaccggaagcccttt
ccctgccccctggactccctgagagtcccccctccactcactccactctctaccattcgt
aactttaccctggggggccccagtgccggggtcacaggaccaggggccggtggaggcaac
gaaggaccccggctgccaggcagcagctcggcagcagccgccgctgcggccgcctataac
cctcaccacctgccgctgcggcccattctgaggcctcgcaagtaccccaacagacctagc
aagaccccagtgcacgagaggccatacccgtgcccggcagaaggctgcgaccggcggttc
tcacgctccgacgagctcacgcggcacatccgcatccacacgggccacaagcccttccag
tgccggatttgcatgcgcaacttcagccgcagtgaccacctcaccactcacatccgcacg
cacactggcgagaagcccttcgcctgtgactactgcggccgcaagtttgcccggagtgac
gagaggaagcgccacaccaagatccacctgagacagaaggagcggaaaagcagtgcgccc
tcgtcctcggtgccggccccctccgcggccccctgcgccgggggcacgcaggccggggct
gccctgtgcggcagcaacagcagcactatcggcggagggccgctagccccttgctcctct
aggacccggacaccttga

KEGG   Oryctolagus cuniculus (rabbit): 100355500
Entry
100355500         CDS       T03373                                 
Symbol
EGR3
Name
(RefSeq) early growth response 3
  KO
K12497  early growth response protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04625  C-type lectin receptor signaling pathway
ocu05161  Hepatitis B
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100355500 (EGR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100355500 (EGR3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100355500 (EGR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100355500 (EGR3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100355500 (EGR3)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 DUF3446 zf-C2H2_4 zf-C2HC_2 zf-BED zf-H2C2_5 zf-C2H2_6
Other DBs
NCBI-GeneID: 100355500
NCBI-ProteinID: XP_008248088
Ensembl: ENSOCUG00000000194
LinkDB
Position
Un
AA seq 339 aa
MATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSA
GILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVPFHDPQGNPG
LAYSPQDYQSAKPALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPL
ETIKAFKDKQIHPGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSR
SDELTRHLRIHTGHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDER
KRHAKIHLKQKEKKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctacagagaatgtgatggacatcggtctgaccaacgagaagcccaacccggaactc
tcgtactccggctccttccagccggcccccggcaacaagaccgtgacctacttgggaaag
ttcgcgtttgactccccttccaactggtgccaagacaacatcatcagcctcatgagcgcc
ggcatcttgggggtgcccccggcctcgggggcgctcagcacgcagacgtccaccgccagc
atggtgcagccgccgcagggcgacgtggaggccatgtacccggcgctgcccccctattcc
aactgtggcgatctctactcggagcccgtgcctttccacgacccccagggcaaccccggg
ctcgcctattccccccaggattaccaatcggccaagccggccctggacagcaacctcttt
cccatgatccccgactacaacctgtaccaccaccccaacgacatgggctccatcccggag
cacaagcccttccagggcatggaccccatccgcgtcaacccgccccctatcaccccgctg
gagaccatcaaggcgttcaaggacaagcagatccacccgggcttcggcagcctgccccag
ccgccgctcacgctcaagcccatccggccccgcaagtaccccaaccggcctagcaagacc
ccgctgcacgagcggccgcacgcctgcccggccgagggctgcgaccgccgcttcagccgc
tcggacgagctgactcggcacctacgcatccacaccggccacaagcccttccagtgccgg
atctgcatgcggagcttcagccgcagcgaccacctcaccactcacatccgcacccacacg
ggcgagaagcccttcgcctgcgagttctgcgggcgcaagtttgcgcgcagcgacgagcgc
aagcgccatgccaagatccacctcaagcagaaggagaagaaggcggagaaagggggcgcg
ccctccgcgtcctcggcgcccccggtgtccctggcccctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system