KEGG   Oryctolagus cuniculus (rabbit): 100351436
Entry
100351436         CDS       T03373                                 
Symbol
USP8
Name
(RefSeq) ubiquitin specific peptidase 8
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04137  Mitophagy - animal
ocu04144  Endocytosis
ocu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351436 (USP8)
   04137 Mitophagy - animal
    100351436 (USP8)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100351436 (USP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ocu01002]
    100351436 (USP8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351436 (USP8)
   04121 Ubiquitin system [BR:ocu04121]
    100351436 (USP8)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100351436 (USP8)
Peptidases and inhibitors [BR:ocu01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   100351436 (USP8)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Others
   Others
    100351436 (USP8)
Ubiquitin system [BR:ocu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100351436 (USP8)
SSDB
Motif
Pfam: UCH USP8_dimer UCH_1 Rhodanese Metallothio_Pro HscB_4_cys
Other DBs
NCBI-GeneID: 100351436
NCBI-ProteinID: XP_002717847
Ensembl: ENSOCUG00000003686
UniProt: G1SK77
LinkDB
Position
17:complement(21977610..22059356)
AA seq 1088 aa
MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSAQKIFKAAEECRLDRDEERAY
VLYMKFVTVYNLIKKRPDFKQQQDYFHSILGPANIKKAIEEAERLSESLKLRYEEAEVRK
KLEEKDRQEEEQLQQKRQEPGREDVSSSAKGSLENVVDSKNKIQKINGEKSEKNETTKKG
SITAKELYAMMMDKNISLIVMDARRMQDYQDSCISNSLSVPEEAISPGVTASWIEANLPD
DSKDTWKKRGNVEYVVLLDWFSSAKDLQLGTTLRSLKDALFKWESKTVLRNEPLVLEGGY
ENWLLCYPQYTTNAKVTPPPRGKNEEVSISLDFTYPSLEEPVPSKVTAQIPPPPVEVDES
IELINDQDGRMGPLHISTPGEPVAASKADVSPIIQPVPITKNIPQVDRTKKPAVKLPEDH
RIKNEKTDHEQQSPQSGKVVPDRSTKPVFPPASAMLTDEEKARIHAEAAFLMEKSKQEKE
LREKQQEEQKEKLKREEQEQKARKKQETEENEITETQQKAKEEMEKREGEQAKKEDKDTS
VKRSKDVTGIKRQSKSEHETSDAKKSVEDRGKRCTTPEVQKKSTGDLPPASVTGDSSAGK
AQREPLTRARSEEMGRIVPGLPSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPP
STPPTHKAKPQIPAERDREPSKLKRSYSSPDITQVIQEEERRKPTVTPTVNRENKPISYP
KAEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHLADYFNRNCY
QDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFKITIGKINDQFAGYSQQDSQ
ELLLFLMDGLHEDLNKADNRKRHKEENNDHLDDFKAAEHAWQKHKQLNESIIVALFQGQF
KSTVQCLTCHKKSRTFEAFMYLSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRA
RRDSLKKIEIWKLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLESLDLSQYVIGPKNNLKK
YNLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTSLG
PRATDVAT
NT seq 3267 nt   +upstreamnt  +downstreamnt
atgcctgctgtggcttcagttcctaaagaactctacctcagttcttcacttaaagacctc
aataagaagacagaagttaaaccagagaaaataagcactaagagttacgtacacagtgcc
cagaagatcttcaaggcagcagaagaatgcaggttagatcgtgacgaggagagggcttat
gtactatatatgaaatttgtgactgtttataatctcatcaaaaaaagacctgatttcaaa
cagcagcaggactactttcattcaatacttggacctgcaaacatcaagaaagctattgaa
gaagccgaaagactctctgaaagccttaaactaaggtatgaagaagctgaggttcggaaa
aagcttgaagaaaaagacagacaggaggaagagcagctgcaacagaaaaggcaggaacca
ggaagagaggatgtcagcagttcagctaaaggctctttggagaatgtagtggattccaaa
aacaaaattcaaaagatcaatggtgaaaagagtgaaaaaaatgagaccacaaagaaagga
tcaatcacagcaaaggaactgtatgcaatgatgatggataaaaacatcagcttgattgta
atggatgctcgaagaatgcaggattatcaggattcctgtatttcaaattctctcagtgtt
cctgaagaagccatcagtccaggagtcactgctagttggattgaagcaaacctcccagat
gattctaaagacacatggaagaagagggggaatgtggaatatgtggtacttcttgactgg
tttagttctgcaaaagatttacaacttggaacaactctacggagtctgaaagatgcactt
ttcaagtgggaaagtaaaactgtcctgcgcaatgaacctttggttttggagggaggctat
gaaaactggcttctttgctatccacagtatacaacaaatgctaaagtcactccaccccca
cgaggcaagaatgaagaggtgtctatttcattggattttacttacccttcactggaagaa
ccagttccttctaaagttactgcccagatcccacctcctcctgtagaagtagatgagagt
atagaattgataaatgatcaagatggaagaatgggaccactgcatatatcaactccaggt
gaaccagttgctgcttccaaagcggatgtttcacccataattcagccagtgcctattaca
aagaatattccacaggttgatcgtactaaaaaacctgcagtcaaattgcctgaagatcat
agaataaaaaatgaaaaaacagaccatgagcaacaatctcctcagagtggaaaagttgtt
cctgatcgttccaccaagccagtctttccccctgcatctgccatgttaacagatgaagaa
aaggctcgtattcatgcagaagctgcttttctaatggagaaaagcaagcaagaaaaagaa
cttcgagaaaagcagcaagaagaacagaaagaaaaactgaagagggaggaacaagagcag
aaagccagaaagaaacaagaaactgaagaaaatgaaatcacagaaacccaacaaaaagca
aaagaagaaatggagaaaagagaaggcgaacaggccaagaaggaagataaagacacctca
gtaaagaggagcaaagacgtaacagggataaaaagacaaagtaaaagtgaacatgagact
tccgatgccaagaaatctgtggaagacagggggaagaggtgcacaactccagaagtgcaa
aagaagtcgacaggagatttgcccccagcatctgtgacaggagattcaagtgcaggcaag
gctcaacgagaacctttgacaagagcaagaagtgaagaaatggggaggattgtaccagga
cttccttcaggctgggccaagtttcttgacccaatcaccggaacctttcgttattaccat
tcacccaccaacactgttcatatgtatccaccggaaatggctccttcatctgcacctcct
tccacccctccaactcataaagccaagccacagattcctgctgaacgagatagggaaccg
tccaaactgaagcgctcctactcctccccagatataactcaggtcatccaagaggaagag
aggaggaaaccaacagtgactccaacagttaatcgggaaaacaagccgataagctaccct
aaagctgagatctcaaggctgtctgcttctcagattcggaacctcaatcctgtttttgga
ggatctggaccagctctcactggacttcgtaatctaggaaatacttgttatatgaactca
atattgcagtgcctatgtaatgccccacatttggctgattattttaacagaaactgttac
caggatgatattaacaggtcaaacttgttagggcataaaggtgaagtggctgaagaattt
ggaataatcatgaaagccctgtggacagggcagtatagatacatcagtccaaaagacttt
aaaattaccattgggaaaatcaatgaccaatttgcaggatacagccagcaagattcccaa
gaacttctcctgttccttatggatggtctccatgaagatttaaacaaagctgataatcgg
aagagacataaagaagaaaataacgatcatcttgatgacttcaaagctgcagaacatgct
tggcagaagcacaagcagctcaatgaatctattattgttgcactttttcagggtcagttc
aaatccacagtgcagtgcctcacctgtcacaaaaagtcaaggacatttgaggccttcatg
tatttgtctctaccactagcatccacaagtaaatgtacattacaggattgccttagacta
ttttccaaagaagaaaaactgacagataacaaccgattctactgcagtcattgcagggct
cgacgtgactccttaaaaaagatagaaatctggaaattgccacccgtgcttttagtgcat
ctgaaacgcttttcctacgatggcaggtggaagcaaaaattacagacatctgtggacttc
ccattagaaagtcttgacttgtcacagtatgttattggcccaaagaacaatttgaagaaa
tacaatttattttctgtttctaatcactacggcggactggatggaggccactacactgcc
tactgcaaaaatgcagcaagacagcggtggtttaagtttgatgatcacgaagtgtctgat
atctctgtttcttctgtgaaatcttcagcagcttatatcctcttttatacttcactggga
ccacgagcaactgatgtagccacataa

DBGET integrated database retrieval system