KEGG   Oryctolagus cuniculus (rabbit): 100351616
Entry
100351616         CDS       T03373                                 
Symbol
ITGAX
Name
(RefSeq) integrin subunit alpha X
  KO
K06462  integrin alpha X
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04610  Complement and coagulation cascades
ocu04810  Regulation of actin cytoskeleton
ocu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100351616 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100351616 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100351616 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ocu04515]
    100351616 (ITGAX)
   04090 CD molecules [BR:ocu04090]
    100351616 (ITGAX)
Cell adhesion molecules [BR:ocu04515]
 Integrins
  Integrin alpha subunits
   100351616 (ITGAX)
CD molecules [BR:ocu04090]
 Proteins
  100351616 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 VWA_CoxE Integrin_alpha
Other DBs
NCBI-GeneID: 100351616
NCBI-ProteinID: XP_017193264
Ensembl: ENSOCUG00000017422
LinkDB
Position
Un
AA seq 1166 aa
MSGARTALLLSVALASAFCFNLDTEKLTTFRMPSTGFGHSVAQYASSWVVVGAPQEITAP
NQTGGLYQCDYGSGLCVPIQLQVPPEAVNMSLGLSLAASTSPSQLLACGPTVQHACRENM
HLTGFCFLLDQTSQQPRMFPTALQECPKLEQDIVFLIDGSGSISFSNFATMKNFVKAVMS
QFPRPSTQFSLMQFSNEFQTHFTFNDFVSSTNPLQLLDRVYQLMGTTHTATAILRVVDQL
FHASTGARKDATKILIVITDGQKLDDPLGYEDVIPKAEAAGIIRYAIGVGLAFQVVSSLR
ELHDIASEPAHEHVFRVENFDALRDIQGRLKEKIFAIEGTETMKSSAFELEMSQEGFSAV
LTPEGPVLGAVGSFDWSGGAFLYPPGGSPTFINMSQQNVDMRDSYLGYSSQLVLWKGVQS
LVLGAPRYEHTGKVVLFTQMSTHWEMRAEVTGTQIGSYFGSSLCSVDVDRDGSTDLVLIG
APHYYEQTRGGRVSVCPLPRGQQAPWRCERVLRGEQGHPWGRFGAALTVLGDVNGDQLAD
VAIGAPGEQENQGAIYLFHGAPGLDMSPTHSQRIAGAQLSPTLQYFGQALSGGQDLTRDG
LMDLAVGAQGQVLLLRTRPILRVRVDMRFAPAEVTRSVFECREPAASLQALGDAFVCLQV
YESPKNQLGELRSSVSFDLALDPGRLNPRAVFKETKTRSLSREQELGLDPYCEALPLLLP
ACVEDVVTPITLRLNFSLVGMPLPSLGDLRPMLAVDAQTYFTASLPFEKNCGADHICQDD
LAISFGFSGLKILVVGNNLELNAEVTVRNDGEDSYGTTVTFSYPAGLSYRRVAGAQTQLQ
LQPLRLTCDSVPSGSQDTRSTSCSLKHLIFRGGTQITFLTTFDVSPKAELGDRLLLTANV
SSENNTPRTSKSTFQLELPVMYAVYTVISSHEQSTKYLNFSASEKEGSGTAQHRYQVNNL
GQRDLPVSITFWVPVELNGARVWTEVEVSHPQNPAVQCPSEKVAPESGLLTHIHKSAVLD
CSIAHCLRFRCHIPAFGIQEELHFTLKGNLSFAWVSQMPQKKVSVVSVAEITFNRAVYSQ
VPGEEPFMRAQVETVLEEYEEHDPVPLVVGSCVGGLLLLALISATLYKLGFFKRRYKEML
GEKPGDAATFPGEDASCGASDLPLSQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgagtggggccaggacagccttgctcctgtctgtagccctggcttctgctttctgcttc
aacttggacacagagaagctgaccacctttcgcatgcccagcactggctttggacacagc
gtggcccagtacgccagctcctgggtggtggtcggagccccccaggagataacagctccc
aaccaaacaggcggcctctaccagtgtgactacggatcaggcttatgcgtgcccatccag
ctgcaggtcccccccgaggctgtgaacatgtccctgggcctgtctttggcagcctccacc
agcccctcccagctgctggcctgtggccctaccgtgcagcatgcatgcagggagaacatg
cacttgaccgggttctgcttcctgctggaccaaacctcccagcagcccaggatgttcccg
actgccctgcaagagtgtcccaagctggagcaggacattgtattcctgatcgatggctct
ggcagcatctccttctccaattttgccaccatgaagaacttcgtgaaggctgtgatgagc
cagttccccagacccagcacccagttctccctgatgcaattctccaacgaattccaaaca
cacttcaccttcaacgacttcgtctccagcacaaatcctctgcagctgttggatcgtgtg
tatcagctgatggggaccacccacacagcaacagccatcctgagggtcgtagaccagctg
ttccatgcctccactggggcccgcaaagatgccaccaagatccttattgtcatcactgat
ggccagaaactagatgaccccctgggttatgaggacgtcatccccaaggctgaggcagcg
ggcataattcgctacgcaatcggggtgggattggctttccaagtcgtctcttccctaagg
gaactacatgacattgcatcggagcccgcccacgaacacgtatttagagtggagaacttt
gatgctttgagagatatccaaggccggctgaaggagaagatctttgccatcgaggggaca
gagaccatgaagagcagcgcctttgagctggagatgtcccaggagggcttcagcgccgtg
ctcacgcctgaaggaccggtgctgggggctgtgggcagcttcgattggtccgggggtgct
ttcctgtacccccccggcgggagccccaccttcatcaacatgtctcagcagaacgtggac
atgagggactcctacctgggctactccagccagctggtgctttggaagggggtgcagagc
ctggtcctgggggcgcctcgctacgagcacacagggaaggtcgtcctcttcacccagatg
tccacgcactgggagatgagagctgaagtcacagggacccagatcggctcctacttcggg
agctccctctgctccgtggacgtggacagagacggcagcaccgatctggtcctcatcggg
gccccccattactatgagcagacgcgagggggccgggtgtccgtgtgtcccttgccccgg
gggcagcaggctccgtggcgatgtgagcgtgttctccgcggggagcagggccacccctgg
ggccgcttcggggcggctctgaccgtgctgggggacgtgaacggggaccagctggcagat
gtggccatcggggccccaggggagcaggagaaccagggcgctatctacctgtttcatgga
gccccggggctggacatgagtcccacccacagccagcgcatcgcgggtgcccagctctcc
cccacgctccagtatttcggtcaggcgctgagcgggggtcaggacctcacccgagacggc
ctgatggatctggctgtgggggcccagggacaggtgctgctgctaaggaccagacctatt
ctcagggtgagggtggacatgcgcttcgcgcctgcggaggtcaccaggtctgtgtttgag
tgtcgggagccggcggcctctttgcaggcgctgggggacgccttcgtctgccttcaggtt
tatgaaagtcccaagaaccagctgggtgaactcagaagctctgtgtcctttgaccttgcc
cttgaccctggccgcctgaatccccgagccgtcttcaaggagacaaaaacccggagtctg
agccgagagcaagaacttggcttggacccgtactgcgaagccctgccgctgctcctcccg
gcctgtgtggaggacgtggtgacacctatcaccttgcgtctcaacttctccctggtgggc
atgcccctcccttccttgggagacctccggccgatgctggccgtggatgctcagacatat
ttcacggcctctctcccctttgagaagaactgtggagccgaccacatctgccaggatgat
cttgccatctcctttggcttctcgggcttgaagatcctggtggtggggaacaacctggag
ctgaatgcggaggtgactgtgcggaatgatggcgaagactcctacggaaccaccgtcacc
ttctcctacccggcagggctgtcttaccgacgcgtggcaggggcccagacccagctgcag
ctgcagcccctgcgtctgacatgtgacagcgtcccctccgggagccaggacacccggagc
accagctgcagcctcaaacacctcatcttccgcgggggcacccagatcaccttcttgact
acctttgacgtctcccctaaggctgagctgggagaccggctgcttctgacagccaacgtg
agcagtgagaacaacacgcccaggaccagcaagagcaccttccagctggagctcccggtc
atgtatgccgtctacaccgtgatcagcagccacgagcagtctaccaagtacctgaacttc
tcggcctcagagaaggaggggagtggcacggcccagcacagataccaggtcaacaaccta
ggacagagggacctaccggtcagcatcaccttctgggtgccagtggagctgaatggggca
cgcgtgtggacggaggtggaggtctcccatccccagaacccggccgtccagtgcccttcg
gagaaagttgctccagagtccgggctcctgacccacattcacaaaagtgctgtgctggac
tgcagcattgcgcactgcctgaggttccgctgccacattcccgccttcggcatccaggag
gagctccacttcaccctgaagggcaacctcagcttcgcctgggtcagccagatgccacaa
aagaaggtgtcggtggtgagcgtggccgagatcaccttcaacagggccgtgtactcccaa
gttccgggtgaggagccctttatgagagcccaggtggagacggtgctggaggagtatgag
gagcacgaccccgtccccctggtggtgggcagctgtgtgggcggcctgctgctgctggct
ctcatctcagccaccctgtacaagcttggcttcttcaagcgccggtacaaggagatgctg
ggcgagaagccgggagacgcggccaccttccccggggaggacgccagctgcggggcttca
gatttgcctttgtcccagtga

DBGET integrated database retrieval system