KEGG   Oryctolagus cuniculus (rabbit): 100351874
Entry
100351874         CDS       T03373                                 
Symbol
CDKN2B
Name
(RefSeq) cyclin dependent kinase inhibitor 2B
  KO
K04685  cyclin-dependent kinase inhibitor 2B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04218  Cellular senescence
ocu04350  TGF-beta signaling pathway
ocu04934  Cushing syndrome
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05222  Small cell lung cancer
ocu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100351874 (CDKN2B)
   04068 FoxO signaling pathway
    100351874 (CDKN2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100351874 (CDKN2B)
   04218 Cellular senescence
    100351874 (CDKN2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100351874 (CDKN2B)
   05203 Viral carcinogenesis
    100351874 (CDKN2B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100351874 (CDKN2B)
   05222 Small cell lung cancer
    100351874 (CDKN2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100351874 (CDKN2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100351874 (CDKN2B)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank
Other DBs
NCBI-GeneID: 100351874
NCBI-ProteinID: XP_002708099
Ensembl: ENSOCUG00000012306
UniProt: G1T306
LinkDB
Position
1:31778607..31783049
AA seq 138 aa
MRDEDKGMLGGAGSDAGLASAAARGQVEKVRQLLEAGADPNGVNRFGRRPIQVMMMGSAR
VAELLLLHGAEPNCADPATLSRPVHDAAREGFLDTLVALHRAGARLDVRDAGGRLPVDLA
EERGHRDIARYLRAAAGD
NT seq 417 nt   +upstreamnt  +downstreamnt
atgcgagacgaggacaagggcatgctcggtggtgcaggcagcgatgcgggcctggccagc
gccgcggcgcggggccaagtggagaaggtgcggcagctcctggaagccggcgcggatccc
aacggagtcaaccgcttcgggaggcgcccgatccaggtcatgatgatgggcagcgcccgc
gtggccgagctgctgctgctccacggcgccgagcccaactgcgccgaccccgccaccctc
agccgaccggtgcacgacgccgcccgggagggcttcttggacacgctggtggcgctgcac
cgggccggggcgcggctggacgtgcgcgacgccgggggccgcctgcccgtggacctggct
gaggagcggggccaccgcgacatcgctcggtacctgcgcgccgccgcgggggactga

DBGET integrated database retrieval system