KEGG   Oryctolagus cuniculus (rabbit): 100351924
Entry
100351924         CDS       T03373                                 
Symbol
LEPR
Name
(RefSeq) leptin receptor
  KO
K05062  leptin receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04080  Neuroactive ligand-receptor interaction
ocu04152  AMPK signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100351924 (LEPR)
   04152 AMPK signaling pathway
    100351924 (LEPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100351924 (LEPR)
   04060 Cytokine-cytokine receptor interaction
    100351924 (LEPR)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100351924 (LEPR)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100351924 (LEPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100351924 (LEPR)
   04090 CD molecules [BR:ocu04090]
    100351924 (LEPR)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  Prolactin receptor family
   100351924 (LEPR)
CD molecules [BR:ocu04090]
 Proteins
  100351924 (LEPR)
SSDB
Motif
Pfam: ObR_Ig Lep_receptor_Ig fn3
Other DBs
NCBI-GeneID: 100351924
NCBI-ProteinID: XP_008263329
Ensembl: ENSOCUG00000017347
LinkDB
Position
13:complement(100681621..100894164)
AA seq 1170 aa
MPANATHDYFLLPAGISKNTSNSSGHYEAIIEDKFNSSDTYFSNLSQTTFYCCFWSEQDT
NCSVRADNIEGKTFVSTVNSLVFQQVGANWDIQCQMKGDLKLFICYMESLLKNPFKNVGL
KVHLLYVLPEMLEDSLLVPQKGTFQMVQCNCSVHERCECHVPVPAAKLNYTLLMYFKVTS
GGVFLQSPLMSVQLIDAVKPDPPLGLRMEITDKGNLKISWSNPAQVPFPLQYQVKYSENS
TTIIREVAEIVSATFLLVDSVLPGSSYKAQVRGRRLDGPGTWSDWSTPQIFVTQGTQPLE
PLPTVYHGLCWLKAGIRSQNQESTLIWNVEILIDVIYFPPKILTSVGSNVSFHCIYKNEH
KIVSSKQIVWWMNLAEKIPQSQYTVVNDRVSKVTFPNLNATKPRGKFTYDAVYCCRDHEC
HHRYAELYVVDVNINISCETDGYLTKMTCRWSANTIQSLVGSTLQLRYHRSSLYCSDIPS
IHPISEPKECHLQRDGFYECIFQPIFLLSGYTMWIRVNHSLGSLDSPPTCVLPDSVVKPL
PPSIVKAEITVNIGLLKLSWEKPVFPENNLQFQIRYGLSGNEKQWKVFEVHDSKSKSANL
SVPDLCAVYAAQVRCKRLDGLGYWSNWSKPAYTVVKDVKVPVRGPEFWRIIDGDVTKKER
NVTLLWKPLMKSDSLCSVSRYVVNHYTSHNGTWSEDVGNHTRFTFIWAEQVHTVTVVAIN
SIGASSSNFNLTFSWPVSKVNTVQSLSAYPLNSSCVILSWIPLPSDYNLMYFIIEWKNLN
EDNEIKWLRIPSSVKKYSIHDNFIPIEKYQFSLYPIFMEGVGKPKIINSFTQDNDEKLQN
DAGLYVIVPIIISSSVLLLGTLLISHQRMKKLFWEDVPNPKNCSWAQGLNFQKPETFEHL
FTKHAASVTFGPLLLEPETISEDISVDTSWKNRDEVVPAATVSLLLPSPDFEKDSICIGE
QGNSANFSEVESSQVTCEDESQGQPSVKYATLVSSSKSSDTSDERELINSSVSKCFSSKN
SPLKDSLPNNSWQIESQAFLLLSDQHPNIISPHLTFSEGLDKLLNLEGSFPEENNCEKSV
YYLGVTSIKKRESGVFLTDESGELCPFPAHCLFTDVRILQDTCSQFAENNFDLGTSAKKT
FVSYMPQFQTCSTQTHKIMENKMCDLTVIP
NT seq 3513 nt   +upstreamnt  +downstreamnt
atgccagcaaatgcaacccatgactatttcctcttgcctgctggaatctccaagaacact
tcaaattctagtggacattatgaagcaattattgaagataaatttaattcaagtgacacc
tacttttctaacttatcccaaacaacattttactgttgtttttggagtgagcaagatact
aactgctctgtgcgtgcagacaacattgaagggaagacatttgtttcaacagtaaattcc
ttagtttttcaacaagtaggtgcaaactgggacatacagtgccagatgaaaggggacttg
aaattattcatctgttatatggagtcattacttaagaatccttttaagaatgttggcctt
aaggtccatcttttatatgttctgcctgaaatgttagaagattctcttctggtcccccag
aaaggcacttttcagatggtgcagtgcaactgcagtgttcatgagcgttgtgagtgtcat
gtgcctgtgccagcagccaagctcaactacacccttcttatgtatttcaaagtcacatct
ggtggagtgtttttgcagtcccctctcatgtcggttcagctcatagatgccgtgaagcct
gatccaccgttaggcttgcgtatggaaatcacggacaagggcaatttaaagatttcttgg
tccaacccagcccaggtaccatttccactgcaatatcaagtgaaatactcagagaattcc
acaacaattataagagaagttgctgagattgtatcagctacattcctgctagtagacagt
gtgcttcctgggtcttcatacaaggctcaggtgaggggcaggagactggacggtccagga
acatggagtgactggagtacccctcaaatctttgtcacgcaaggaactcaacctcttgag
ccactaccgactgtctaccatggtctgtgttggttgaaagctggaatcaggagccagaat
caggaatccactctgatatggaatgtggaaatcttaatagatgtcatttactttccacct
aaaattctgacaagtgttgggtctaacgtttcttttcactgcatctataaaaatgagcac
aagattgtgtcctcaaaacagattgtttggtggatgaatttagctgagaaaattcctcaa
agccagtataccgttgtgaatgatcgtgtcagcaaagttacttttcccaatttgaatgca
accaaacctcgagggaagtttacctacgatgcagtgtactgctgccgtgaccatgaatgc
catcatcgctatgcggaattatatgtggttgatgtcaatatcaatatatcatgtgaaact
gatgggtacttaactaaaatgacttgcagatggtcagccaatacaatccaatcacttgtg
ggaagtaccttgcagttgaggtatcataggagcagcctttattgttctgatattccatct
attcatcccatatctgaacccaaagagtgccatttgcagagggatggtttttatgagtgc
atttttcagccaatcttcctattatctggttacacaatgtggattagggtcaaccactcg
ttaggttcacttgactctccaccaacgtgtgtccttcctgattctgtagtgaaaccgttg
cctccatccattgtaaaagcagaaatcactgtaaacattggcttactgaagctatcttgg
gaaaagccagtctttccagagaataatctccagttccagatccgctatggcttaagtgga
aatgaaaagcaatggaaggtgtttgaggtacatgattcaaaatcaaagtctgccaatctg
tcagtaccagacctgtgtgccgtctatgctgctcaggtgcgctgcaagaggttagatgga
ctaggatattggagtaattggagcaagccagcctacactgttgtcaaggatgtgaaagtt
cctgtgagaggacctgaattttggagaataattgatggagatgttactaaaaaggagaga
aatgtcaccttactgtggaagcccctgatgaaaagtgactcactgtgcagtgtgagcaga
tatgtggtaaaccattacacttcccacaatggaacatggtctgaagatgtgggaaatcac
accagattcacttttatttgggcagaacaggtgcatacggttacagttgtggccatcaat
tcaattggtgcttcgtcttccaattttaatttaactttctcatggcctgtgagcaaagta
aataccgtgcagtcactcagtgcttatcctttaaacagcagttgtgtgattctgtcctgg
ataccattgcccagtgactacaacctaatgtattttatcattgaatggaaaaaccttaat
gaagataatgaaatcaagtggcttagaatcccttcatctgttaagaagtattctatccat
gataattttatccccattgagaaatatcagttcagtctttatccaatatttatggaagga
gtgggaaaaccaaagataattaatagtttcacccaagataatgatgagaaactccagaat
gatgctggtctatatgtaatcgtgccaataattatttcctcttctgtcttgttgcttggg
acattgttaatatcacaccaaagaatgaaaaagctgttttgggaagatgttccaaacccc
aagaattgttcctgggcacaaggacttaattttcagaagccagaaacgtttgagcatctt
tttaccaagcatgccgcgtcagtgacatttggccctcttcttttggagcctgaaaccatt
tccgaagatatcagtgttgacacatcatggaagaacagagatgaggtggtgcccgcagct
acggtctcactgcttttgccatctccagattttgaaaaggattctatttgtattggtgag
caaggcaacagtgctaacttctcagaggtggagagctcccaggtaacctgtgaggatgaa
agccagggacagccctccgtgaaatacgccacactggtcagcagctcaaaatcaagtgac
accagcgacgagcgagagctgatcaacagttcagtgagcaagtgcttctctagcaaaaat
tctccgctgaaagattctctccctaataactcatggcagatagagtcccaagcatttctc
ttattatcagatcaacaccccaacataatttcaccacatcttacgttctcagaaggattg
gacaaacttttgaacctggagggaagtttccccgaagaaaataattgtgaaaagtctgtc
tattatttgggtgttacctcaatcaaaaaaagagagagtggtgtgtttttgactgacgaa
tcaggagagctgtgcccgttcccagctcactgtttattcactgacgtcagaatcctccag
gacacctgctcacaatttgcagaaaataatttcgacttaggaacatctgctaagaagacc
tttgtatcttacatgcctcaatttcaaacttgttccactcaaactcataagataatggaa
aacaagatgtgtgacttaactgtaattccatga

DBGET integrated database retrieval system