KEGG   Oryctolagus cuniculus (rabbit): 100352332
Entry
100352332         CDS       T03373                                 
Symbol
XCR1
Name
(RefSeq) X-C motif chemokine receptor 1
  KO
K04193  XC chemokine receptor 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352332 (XCR1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100352332 (XCR1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100352332 (XCR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100352332 (XCR1)
   04050 Cytokine receptors [BR:ocu04050]
    100352332 (XCR1)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   C Chemokine
    100352332 (XCR1)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  C Chemokine
   100352332 (XCR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx MRP
Other DBs
NCBI-GeneID: 100352332
NCBI-ProteinID: XP_008258738
Ensembl: ENSOCUG00000004322
LinkDB
Position
9:complement(14348712..14355670)
AA seq 333 aa
MESSGTLESTTPFEYDIESLLCESKTFVFATFATTILYCLVFLLSLVGNSLVLWVLVKFE
NLESLTNVFILNLCLSDLVFSCLLPVWVSTFYWGWVLGDFLCKLLSMAFSLSLYSSIFFL
TVMTIHRYLSVVSPLSSLRVHTLRCRVLATVAVWAASLLSSVGDAIFHQVLSSDCAYSEL
WGFLASVYQHNIFFLLSMAVILFCYVQILRTLFRSRSKRRHRTVRLIFAIVTAYFLSWAP
YNIILFLETLLKTGVIRSCEVSQHLGYAVLISRNVAFSHCCFNPVLYVFVGVKFRRHLKS
LLRRFWLCRQQVPSPPPLPQSPGAFIYEGASFY
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggagtcctcgggcaccctcgagtccaccacgccttttgagtatgacattgagagcctc
ctgtgtgagagcaagacttttgtcttcgccaccttcgccaccaccatcctgtactgcctg
gtgttcctcctcagcctggtgggcaacagcctggtgctgtgggtgctggtgaaattcgag
aacctggagtccctcaccaacgtcttcatcctcaacctgtgcctgtctgacctggtcttc
tcctgcttgctgcccgtgtgggtctccaccttctactggggctgggtgctgggagacttc
ctctgcaagctgctcagcatggccttctccctcagcctctacagcagtatcttcttcctg
accgtcatgaccatccaccgctacctgtcagtggtcagccccctctccagcctgcgcgtc
cacaccctgcgctgccgcgtgctggcgaccgtggccgtgtgggcagccagcctgctgtcc
tccgtgggcgatgccatcttccaccaggtgctgtcgtccgactgtgcgtattcggaactc
tgggggttcctggcctcggtgtaccagcacaacatcttcttcctgctgtccatggccgtc
atcctattctgctacgtacagattctcaggaccctgttccgctcgcggtccaaacgccgc
caccggacggtcaggctcatcttcgccatcgtgaccgcctacttcctcagttgggctccc
tacaacatcatcctgttcctggagaccctgctgaaaacaggggtcatccggagctgcgag
gtcagccagcatctgggctacgccgtgctcatcagccggaacgtggccttctcgcactgc
tgtttcaaccccgtgctctacgtcttcgtcggggtcaagttccgcagacacctcaaaagt
ctcctgcggcggttctggctgtgccggcagcaggtgcccagcccgcccccgctcccccag
tccccaggtgccttcatctacgagggggcctccttctactga

DBGET integrated database retrieval system