KEGG   Oryctolagus cuniculus (rabbit): 100352775
Entry
100352775         CDS       T03373                                 
Symbol
CDK5
Name
(RefSeq) cyclin dependent kinase 5
  KO
K02090  cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
ocu05010  Alzheimer disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05030  Cocaine addiction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100352775 (CDK5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100352775 (CDK5)
   05022 Pathways of neurodegeneration - multiple diseases
    100352775 (CDK5)
  09165 Substance dependence
   05030 Cocaine addiction
    100352775 (CDK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100352775 (CDK5)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352775 (CDK5)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100352775 (CDK5)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100352775 (CDK5)
Membrane trafficking [BR:ocu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100352775 (CDK5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Haspin_kinase Seadorna_VP7 APH Kinase-like
Other DBs
NCBI-GeneID: 100352775
NCBI-ProteinID: XP_002715121
Ensembl: ENSOCUG00000021398
UniProt: G1U1H1
LinkDB
Position
13:complement(12472393..12476260)
AA seq 292 aa
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSR
NVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYS
TSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPAMTKLPDYKPYP
MYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
NT seq 879 nt   +upstreamnt  +downstreamnt
atgcagaaatacgagaagctggagaagattggggaaggcacttacggaacagtgttcaag
gccaaaaaccgagagactcacgaaatcgtggctctgaaacgcgtgaggctggatgacgat
gacgagggtgtgccgagttcagccctccgggagatctgcctgcttaaggagctgaagcac
aagaacattgtcaggcttcacgatgtcctgcatagtgacaagaagctgactttggttttt
gagttctgtgaccaggacctcaagaagtattttgacagctgcaatggtgacctcgatcct
gagattgtgaagtcattcctcttccagctgctgaaaggcctgggattctgtcacagccgc
aacgtgctgcacagagacctaaagccccagaacctgctcataaacaggaatggggaactg
aaattggccgatttcggcttggctcgagcctttgggattcctgtccgctgttactcagct
gaggtggtcacgctgtggtaccgcccaccggatgtcctctttggggccaagctgtactcc
acgtccatcgacatgtggtcagccggctgcatcttcgcagagctggccaatgccggccgg
cccctcttccctggcaacgatgtggatgaccagctgaagaggatcttccggctgctgggg
acaccaactgaggagcagtggcccgctatgaccaaactgccagattataagccctaccca
atgtacccggccacaacgtccctggtgaacgtcgtgcccaagctcaacgccacagggagg
gacctgctgcagaaccttctgaagtgtaaccctgtccagcgcatctccgcagaagaggcc
ctgcagcacccttacttctcagacttctgtcccccctag

DBGET integrated database retrieval system