KEGG   Oryctolagus cuniculus (rabbit): 100352809
Entry
100352809         CDS       T03373                                 

Symbol
CD3G
Name
(RefSeq) CD3g molecule
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu05142  Chagas disease
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100352809 (CD3G)
   04660 T cell receptor signaling pathway
    100352809 (CD3G)
   04658 Th1 and Th2 cell differentiation
    100352809 (CD3G)
   04659 Th17 cell differentiation
    100352809 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100352809 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100352809 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    100352809 (CD3G)
   05162 Measles
    100352809 (CD3G)
   05169 Epstein-Barr virus infection
    100352809 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100352809 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100352809 (CD3G)
CD molecules [BR:ocu04090]
 Proteins
  100352809 (CD3G)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3 Ig_2
Other DBs
NCBI-GeneID: 100352809
NCBI-ProteinID: XP_002722229
Ensembl: ENSOCUG00000000436
UniProt: G1SDA3
LinkDB
Position
Un
AA seq 182 aa
MEQQKGLAGLILTVFLLQGTMAQIKKENLMIEVDDNRDDGSVLLTCKLPDKNIKWLKDGQ
EVKFRNVSGNKWNLGSSTKDPQGIYSCKGATKSSESLHVYFRMCQNCIELNAATVSGFIF
TEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNNLR
KH
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcagcagaagggtctggctggcctcatcctgactgtctttctccttcaaggtact
atggcccagattaaaaaagaaaatcttatgatagaagtggatgacaatcgagatgatggc
tcagtgcttctgacttgtaaattgccagacaaaaatatcaagtggttaaaagatgggcag
gaagtgaagttccgaaatgtaagtggaaataagtggaacctgggaagtagtaccaaagac
cctcaaggaatatattcgtgtaaaggagcaacgaaaagttcggaatcactccacgtgtat
ttcagaatgtgtcagaactgcattgagttaaatgcagccactgtttccggctttatcttc
actgaaatcatcagcattttcttccttgctgttggagtctacttcattgcaggacaagat
ggagttcgccagtcaagggcttcagataagcagactctgttgcccaatgaccagctctac
cagcccctcaaggatcgggaagatgaccagtacagccatcttcaaggaaacaacttgagg
aagcactga

KEGG   Oryctolagus cuniculus (rabbit): 100355340
Entry
100355340         CDS       T03373                                 

Name
(RefSeq) T-cell surface glycoprotein CD3 gamma chain
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu05142  Chagas disease
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100355340
   04660 T cell receptor signaling pathway
    100355340
   04658 Th1 and Th2 cell differentiation
    100355340
   04659 Th17 cell differentiation
    100355340
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100355340
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355340
   05170 Human immunodeficiency virus 1 infection
    100355340
   05162 Measles
    100355340
   05169 Epstein-Barr virus infection
    100355340
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100355340
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100355340
CD molecules [BR:ocu04090]
 Proteins
  100355340
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3 Ig_2
Other DBs
NCBI-GeneID: 100355340
NCBI-ProteinID: XP_002722743
Ensembl: ENSOCUG00000007865
LinkDB
Position
Un
AA seq 182 aa
MEQQKGLAGLILTVFLLQGTMAQIKKENLMIEVDDNRDDGSVLLTCKLPDKNIKWLKDGQ
EVKFRNVSGNKWNLGSSTKDPQGIYSCKGATKSSESLHVYFRMCQNCIELNAATVSGFVF
TEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNNLR
KH
NT seq 549 nt   +upstreamnt  +downstreamnt
atggagcagcagaagggtctggctggcctcatcctgactgtctttctccttcaaggtact
atggcccagattaaaaaagaaaatcttatgatagaagtggatgacaatcgagatgatggc
tcagtgcttctgacttgtaaattgccagacaaaaatatcaagtggttaaaagatgggcag
gaagtgaagttccgaaatgtaagtggaaataagtggaacctgggaagtagtaccaaagac
cctcaaggaatatattcgtgtaaaggagcaacgaaaagttcggaatcactccacgtgtat
ttcagaatgtgtcagaactgcattgagttaaatgcagccactgtttccggctttgtcttc
actgaaatcatcagcattttcttccttgctgttggagtctacttcattgcaggacaagat
ggagttcgccagtcaagggcttcagataagcagactctgttgcccaatgaccagctctac
cagcccctcaaggatcgggaagatgaccagtacagccatcttcaaggaaacaacttgagg
aagcactga

DBGET integrated database retrieval system