KEGG   Oryctolagus cuniculus (rabbit): 100353506
Entry
100353506         CDS       T03373                                 
Symbol
DPYSL5
Name
(RefSeq) dihydropyrimidinase like 5
  KO
K07529  dihydropyrimidinase-like 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100353506 (DPYSL5)
SSDB
Motif
Pfam: Amidohydro_1 Amidohydro_3 PDH_E1_M
Other DBs
NCBI-GeneID: 100353506
NCBI-ProteinID: XP_008252868
Ensembl: ENSOCUG00000014846
UniProt: A0A5F9DL31
LinkDB
Position
2:complement(159091436..159170095)
AA seq 662 aa
MLGCRLSPPPPNLLTRGGERRGGTTRSLIGRGLSQPPPGPPPPLATSDSRARRAEAATER
AFPQPPPPPRAPAAPAPRRDAETDGPTDLRGRSIPEENMLANSASVRILIKGGKVVNDDC
THEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFHQTFMNATCVDDF
YHGTKAALVGGTTMVMGHVLPDKETSLVDAYEKCRALADPKVCCDYALHVGITWWAPKVK
AEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGA
KEALDLGITGPEGIEISRPEELEAEAAHRVITIANRTHCPIYLVNVSSISAGDVIAAAKM
QGKVVLAETTTAHATLTGLHYYHQDWAHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIV
ASDHRPFTTKQKAMGKEDFTKIPHGVSGVQDRMSVVWERGVVGGKMDENRFVAVTSSNAA
KILNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQGGDFNLYENMRCHGVPLVTISR
GRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKMKGVDRTPYLGDVAVVVHT
GKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRSSG
IW
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgctggggtgccgcctgtccccgcctccccctaacctgctaactcgaggtggggagcgc
agaggaggaaccacgagatccctgattggccgaggcctctcccagcccccacccggtccc
cctcccccgctcgccacttcggactcccgcgcccggcgcgcagaggctgccaccgagcga
gcgttcccgcagccgccgccgccgccccgagcacccgcagctccggcgccgcggcgagac
gcagagacggacggacccacggaccttcgcggccgcagcatcccggaggagaacatgctt
gccaactcagccagcgtgcggattctcatcaagggaggcaaggtggtgaacgatgactgc
acccacgaggccgacgtctacatcgagaacggcatcatccagcaggtgggccgggagctc
atgattcccggaggggccaaggtgatcgacgccacggggaagctggtgatccctggaggc
atcgacaccagcacccacttccaccagaccttcatgaacgccacgtgcgtggacgacttc
taccatggcaccaaggcggcgctcgtgggaggcaccaccatggtcatgggccacgtcctg
cctgacaaggagacctcccttgtggatgcctatgagaagtgccgggccctggccgacccc
aaggtctgctgcgactacgccctccacgtggggatcacctggtgggcgcccaaggtgaaa
gcagaaatggagaccctggtgcgagagaagggcgtcaactccttccagatgttcatgacc
tacaaagacttgtacatgctccgggacagcgagctgtaccaagtgctgcacgcgtgcaag
gacattggggccattgcccgggtccacgcggaaaacggggagctggtggccgagggtgct
aaggaggccctggatctggggattacaggcccagaaggcatcgagatcagccgtccggag
gagctggaagcggaagctgctcaccgtgtcatcaccatcgccaacaggactcattgtccg
atctacctggtcaacgtgtccagcatctcggctggtgacgttatcgcagctgctaagatg
caagggaaggttgtgctggccgagaccaccaccgcccacgccacgctgaccggcctgcac
tactaccaccaggactgggcccacgcggccgcctacgtcacggtgcctcccctgaggctg
gacaccaacacctccacctacctcatgagcctgctggccaatgatactctcaacatcgtg
gcgtcagatcaccggccgttcaccacgaagcagaaggccatgggcaaggaggacttcacc
aagatcccgcacggagtgagcggcgtgcaggaccgtatgagcgtcgtgtgggagagaggc
gtggttggaggaaaaatggatgagaaccgttttgtggccgtcaccagttccaacgcggct
aagattctcaacctgtatccccgcaagggccgcatcatccctggcgccgacgccgacgtg
gtggtgtgggacccggaagccacgaagaccatctcggccagcacccaggtgcagggggga
gacttcaacctgtacgagaacatgcgctgtcacggcgtgcccctggtcaccatcagccgg
ggccgtgtcgtctacgagaacggcgtcttcatgtgcgccgagggcaccggcaagttctgc
ccgctgaggtccttcccagacacagtctacaagaagctggtccagagagagaagaccctg
aagatgaagggagtggaccgcactccctacctgggggacgtcgccgttgtcgtgcacacg
gggaaaaaggagatgggcacgccgctggccgacacgcccacgcggcccgtcacccggcac
gggggcatgcgggacctccacgagtccagcttcagcctctcgggttctcagatcgacgac
cacgttccaaagcgagcctcggcccggatcctcgcgccccctggcggcaggtcaagcggc
atttggtaa

DBGET integrated database retrieval system