KEGG   Oryctolagus cuniculus (rabbit): 100354504
Entry
100354504         CDS       T03373                                 
Symbol
ISG15
Name
(RefSeq) ISG15 ubiquitin-like modifier
  KO
K12159  ubiquitin cross-reactive protein
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu05165  Human papillomavirus infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    100354504 (ISG15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100354504 (ISG15)
   05169 Epstein-Barr virus infection
    100354504 (ISG15)
   05165 Human papillomavirus infection
    100354504 (ISG15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100354504 (ISG15)
Ubiquitin system [BR:ocu04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   100354504 (ISG15)
SSDB
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2
Other DBs
NCBI-GeneID: 100354504
NCBI-ProteinID: XP_008251811
UniProt: A0A5F9C6D5
LinkDB
Position
Un
AA seq 164 aa
MGKDLKVKMLGSKEISVPLSESLTASELKRRIAQETGVPAFQQLLAVHPGGAALLEEVPL
VAQGLGPGSTVLLLVQKCDNPLSILVRNDRGRSSAYEVLLTQTVAQLKLQVAQREGLQPD
LFWLSFEDRPMEDQPLLGESGLQPRCTVYLNLRLRGGSAGTQPC
NT seq 495 nt   +upstreamnt  +downstreamnt
atggggaaggacctgaaggtgaagatgctgggcagcaaagagatctcagtgcccctgagc
gagtccctgacggcgtcggagctgaagcggcggatcgcccaggagactggcgtgccggcc
ttccagcagctcctggctgtgcaccccgggggggcggcgctgctggaggaggtccccctg
gtcgcccagggcctggggccgggaagcacggtgctgctgctggtgcagaagtgtgacaac
ccgctgagcatcctggtgcgcaatgacaggggccgcagcagcgcctacgaggtgctgctc
acccagacggtggcccagctcaagctgcaggtggcccagcgggagggcctgcagccggac
ctgttctggctgagcttcgaggacaggcccatggaggaccagcccctgctgggggagtcc
ggcctccagccgcggtgcaccgtgtacctgaacctccgcctgcggggcggatctgccggg
acccagccctgttaa

DBGET integrated database retrieval system