KEGG   Oryctolagus cuniculus (rabbit): 100354874
Entry
100354874         CDS       T03373                                 
Symbol
CDC20
Name
(RefSeq) cell division cycle 20
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100354874 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100354874 (CDC20)
   04114 Oocyte meiosis
    100354874 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100354874 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100354874 (CDC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100354874 (CDC20)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100354874 (CDC20)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     100354874 (CDC20)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100354874 (CDC20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 eIF2A Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 100354874
NCBI-ProteinID: XP_008263638
Ensembl: ENSOCUG00000011340
UniProt: A0A5F9D004
LinkDB
Position
13:complement(123296019..123309784)
AA seq 542 aa
MLRAESLSSVGLACRSRSGIGICSVRTARRASAPRTPPARGAAMAQFVFESDLHSLLQLD
APIPNAPPARWQRKAKETAGPAPSPMRAANRSHSAGRTPGRTPGKSNSKGQTTPSKPGGD
RYIPQRSASQMEVASFLLSKENQPENSQSPTKKEHQKAWALNLNGFDVEEAKILRLSGKP
QNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLMDWSSGNV
LAVALDNSVYLWSASSGDILQLLQMEQPGDYVSSVAWIKEGNYLAVGTSSAEVQLWDVQQ
QKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRW
APDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNILATGGGT
SDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVA
ELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASASKSSLIHQG
IR
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgctcagagcggagagtttaagtagcgtaggcctggcgtgccgaagccggtccgggatt
ggaatctgttccgtacgcacggctcggcgagcatcagctcccaggacccctcccgctcgc
ggcgctgccatggcgcagttcgtgttcgagagtgacctgcactcgctgctgcagctggac
gcacccatccccaatgcaccccctgcgcgctggcagcgcaaggccaaggaaaccgcgggg
ccggccccgtcccccatgcgggcagccaaccgatcccacagcgccggcagaaccccgggc
cgcactcctggcaagtctaattccaagggacagaccacccctagcaaacccggcggtgac
cgctatattccccaacgcagcgcttcccagatggaggtggcgagcttcctcctgagcaag
gagaaccagccagaaaacagccagtcgcccaccaagaaggagcatcagaaagcatgggct
ttgaacctgaacggttttgatgtggaggaggccaagatccttcggctcagtgggaaacca
cagaatgccccagagggttaccagaacagactgaaagtactgtacagccagaaagccacg
cccggctccagccggaagacctgtcgctacattccctccctaccagaccggatcctggat
gcccctgaaatccgaaatgactactacctgaacctcatggactggagctctgggaatgtt
ctggcagtagcactggacaacagcgtgtacctgtggagtgcaagctctggtgacatcctg
cagctgttgcaaatggagcagcctggggactacgtatcctctgtggcctggatcaaagag
ggcaactacctggctgtgggcaccagcagtgctgaggtgcagctctgggatgtgcagcag
caaaaacggcttcgaaacatgaccagtcactctgcccgagtgggctccctgagctggaac
agctatatcctctccagtggttcacgctccggccatatccaccaccatgatgttcgggta
gcagaacaccacgtggccaccctgagtggccacagccaggaagtgtgtgggctgcgctgg
gccccagacggacggcacttggctagtggaggcaacgataacttggtcaatgtgtggcct
agtgctcctggagagggcggctgggttcccctgcaaacattcacccagcatcaaggggct
gtcaaggctgtagcttggtgtccctggcagtccaatatcctggcgacaggagggggcacc
agtgatcgacacatccgcatctggaacgtgtgctccggggcctgtctgagtgctgtggac
gcccattcccaggtgtgctccatcctctggtctccccactacaaggagctcatctcaggc
catggctttgcacagaaccagctggtcatctggaagtacccaaccatggccaaggtggct
gagctcaaaggtcacacagcccgggtcctgagtctgaccatgagcccggacggggccaca
gtggcatcggcagcagcagatgagaccctaaggctgtggcgctgcttcgagctggaccct
gcacggcggcgggagcgggaaaaagccagcgcatccaaaagcagcctcatccaccaaggc
atccgttga

DBGET integrated database retrieval system