KEGG   Oryctolagus cuniculus (rabbit): 100354960
Entry
100354960         CDS       T03373                                 
Symbol
UBE2E1
Name
(RefSeq) ubiquitin-conjugating enzyme E2 E1
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100354960 (UBE2E1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100354960 (UBE2E1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100354960 (UBE2E1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100354960 (UBE2E1)
SSDB
Motif
Pfam: UQ_con RWD SR-25
Other DBs
NCBI-GeneID: 100354960
NCBI-ProteinID: XP_017202234
Ensembl: ENSOCUG00000006026
UniProt: G1SQ61
LinkDB
Position
14:10131655..10206530
AA seq 193 aa
MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAKRIQKELADIT
LDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFTPEYPFKPPKVTFRTRIY
HCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEH
DRMARQWTKRYAT
NT seq 582 nt   +upstreamnt  +downstreamnt
atgtcggatgacgattcgagggccagcaccagctcctcctcatcttcgtcctccaaccag
caaaccgagaaagaaacaaacacccccaagaagaaggagagtaaagtcagcatgagcaaa
aactccaaactcctctccaccagcgccaagaggattcagaaggaactggcagacatcact
ttagaccctccacccaactgcagcgctggccccaaaggtgataacatctatgagtggaga
tccaccattctagggcctccaggatctgtgtacgaaggtggcgtcttctttctcgatatt
acttttacaccagaatatcccttcaagcctcccaaggttacatttcggacaagaatctat
cactgtaatattaacagtcaaggagttatttgcttggacatattgaaagataattggagt
ccagcactaactatttctaaagtcctcctttccatctgctcacttcttacagactgtaat
cctgccgaccctctggtgggcagcatcgccacccagtacatgaccaacagagcagagcac
gaccggatggcccgacagtggaccaagagatacgccacataa

KEGG   Oryctolagus cuniculus (rabbit): 100357218
Entry
100357218         CDS       T03373                                 
Symbol
UBE2E3
Name
(RefSeq) ubiquitin conjugating enzyme E2 E3
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100357218 (UBE2E3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357218 (UBE2E3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100357218 (UBE2E3)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100357218 (UBE2E3)
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100357218
NCBI-ProteinID: XP_002712367
LinkDB
Position
7:120825620..120936276
AA seq 207 aa
MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLS
TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY
PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV
GSIATQYLTNRAEHDRIARQWTKRYAT
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtccagtgataggcagaggtccgacgatgagagccccagcaccagcagtggcagttca
gatgcggaccagagagacccagccgctccagagcctgaggaacaagaagaaagaaaacct
tctgccacccagcagaagaagaacaccaaactctctagcaaaaccactgctaagttatcc
actagtgctaaaagaattcagaaggagctagctgaaataacccttgatcctcctcctaat
tgtagtgctgggcctaaaggagataacatttatgagtggagatcaactatacttggtcca
ccaggttctgtatatgaaggtggtgtgttttttctggatatcacattttcatcagattat
ccatttaaaccaccaaaggttactttccgcaccagaatctatcactgcaacatcaacagt
cagggagtcatctgtttggacatccttaaagacaactggagtcctgctttgactatttca
aaggttttgctgtctatttgttcccttttgacagactgcaaccctgcggatcctctggtt
ggaagcatagccactcagtatttgaccaacagagcagaacatgacaggatagccagacag
tggaccaagagatacgcaacataa

KEGG   Oryctolagus cuniculus (rabbit): 103350360
Entry
103350360         CDS       T03373                                 
Symbol
UBE2E2
Name
(RefSeq) ubiquitin-conjugating enzyme E2 E2
  KO
K20217  ubiquitin-conjugating enzyme E2 E [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103350360 (UBE2E2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    103350360 (UBE2E2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     103350360 (UBE2E2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   103350360 (UBE2E2)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 103350360
NCBI-ProteinID: XP_008264280
LinkDB
Position
14:9537339..9922148
AA seq 201 aa
MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRI
QKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPK
VTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQ
YMTNRAEHDRMARQWTKRYAT
NT seq 606 nt   +upstreamnt  +downstreamnt
atgtccactgaggcacaaagagttgatgacagtccaagcactagtggaggaagttctgat
ggagaccagcgtgaaagtgttcagcaagaaccggaacgagagcaagttcagcccaagaag
aaggagggaaaaatatccagcaagacggccgctaaattgtcgactagtgctaaaagaatt
cagaaggaacttgcagaaattacattggaccctcctcccaactgtagtgctggacccaaa
ggagacaacatttatgaatggaggtcaactatattgggacccccaggatctgtctatgaa
ggaggggtgttctttcttgacataaccttttcaccagactatccgtttaaaccccctaag
gttacgttccgaacaagaatctatcactgtaacatcaacagccaaggcgtgatctgtctg
gacatcctgaaggacaactggagtccagccctgaccatctccaaagtcctcctctccatc
tgctccctgctcacagactgcaaccctgccgaccctctggtgggcagcatcgccacccag
tacatgaccaacagagcagagcacgaccggatggcccgacagtggaccaagcggtacgcc
acctag

DBGET integrated database retrieval system