KEGG   Oryctolagus cuniculus (rabbit): 100355281
Entry
100355281         CDS       T03373                                 
Symbol
WASHC4, KIAA1033
Name
(RefSeq) WASH complex subunit 4
  KO
K18465  WASH complex subunit 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355281 (WASHC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100355281 (WASHC4)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100355281 (WASHC4)
SSDB
Motif
Pfam: WASH-4_N WASH-7_mid WASH-7_C
Other DBs
NCBI-GeneID: 100355281
NCBI-ProteinID: XP_017197622
Ensembl: ENSOCUG00000005030
LinkDB
Position
4:complement(91178011..91248297)
AA seq 1173 aa
MAVETLSPDWEFDRVDDGSQKIHAEVQLKNYGKFLEEYTSQLRRIEDALDDSIGDVWDFN
LDPIALKLLPCEQSSLLELIKTENKVLNKVITVYAALCCEIKKLKYEAETKFYNGLLFYG
EGATDSSMVEGDCQIQMGRFISFLQELSCFVTRCYEVVMNVVHQLAALYISNKIAPKIIE
TTGVHFQTMYEHLGELLTVLLTLDEIIDNHVTLKDHWTMYKRLLKSVHHNPSKFGIQEEK
LKPFEKFLLKLEGQLLDGMIFQACIEQQFDSLNGGVSVSKNSTFAEEFAHSIRSIFANVE
AKLGEPSEIDQRDKYVGICGLFVLHFQIFRTVDKKFYKSLLDICKKVPAITLTANIIWFP
DNFLIQRIPAAAKLLDRKSLQAIKMHRDTFLQQKAQSLTKDVQSYYVFVSSWMMKMESIL
SKEQRMDKFAEDLTNRCNIFIQGFLYAYSISTIIKTTMNLYMSLQKPMTKTSVKALCRLV
ELLKAIEHMFYRRSMVVADSVSHITQHLQHQALNSISVAKKRVISDKKYSEQRLDVLSAL
VLAENTLNGPSTKQRRLIVSLALSVGTQMKTFKDEELLPLQVVMKKLDLISELRERVQTQ
CDCCFLYWHRAVFPIYLDDVYENAVDAARLHYMFSALRDCVPAMMHARHLESCEILLDCY
DKEIMEILNEHLLDKLCKEIEKDLRLSVHTHLKLDDRNPFKVGMKDLALFFSLNPIRFFN
RFIDIRAYVTHYLDKTFYNLTTVALHDWATYSEMRNLATQRYGLVMTEAHLPSQTLEQGL
DVLEIMRNIHIFVSRYLYNLNNQIFIERTSNNKHLNTINIRHIANSIRTHGTGIMNTTVN
FTYQFLKKKFYIFSQFMYDEHIKSRLIKDIRFFREIKDQNDHKYPFDRAEKFNRGIRKLG
ITPEGQSYLDQFRQLISQIGNAMGYVRMIRSGGLHCSSNAIRFVPDLEDIVNFEELVKEE
GLADETLKAARHLDSVLSDHTRNSAEGTEYFKMLVDVFAPEFRRPKNIHLRNFYIIVPPL
TLNFVEHSISCKEKLNKKKKIGAAFTDDGFAMGVAYILKLLDQYQEFDSLHWFQSVREKY
LKEIRAVAKQQNVQSASQDEKLLQTMNLTQKRLDIYLQEFELLYFSLSSARIFFRADKTA
AEENQEKKEKEEETKTSNGDLPDSTVSAEPVVK
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggcggtggagactctgtccccagattgggagtttgaccgcgttgacgacggctcgcag
aaaattcatgctgaagtccagcttaagaattacgggaaatttctcgaggagtatacgtct
caactgagaagaatcgaggatgcgcttgatgattctattggagacgtctgggatttcaat
cttgatcctatagcattaaagcttttgccttgtgaacagtcttcccttttggaactcata
aagactgaaaacaaggtcttaaacaaagtcatcactgtttatgctgcactttgttgtgaa
ataaagaaattaaaatatgaggctgaaactaaattttacaatggtctcttgttttatgga
gaaggagctacagattctagcatggtggaaggtgattgccagattcaaatgggaagattc
atttcattcttacaggaactgtcctgtttcgttaccaggtgctatgaagtggtgatgaat
gtagtccatcagttggctgccctctatatcagtaacaagattgcacccaaaattatagag
acaactggagttcattttcagactatgtatgagcacttgggagaactgctaacagttttg
ctcaccctcgatgaaatcattgataatcatgtcaccttgaaagaccactggactatgtac
aaaaggttactgaaatctgtccatcacaatccttcaaaatttggaattcaggaagaaaaa
ttgaagccatttgagaagttcttgctgaagctagaagggcagttacttgatggaatgata
ttccaggcctgtatagaacaacagtttgattctctcaatggaggagtatctgtgtcaaaa
aatagcacttttgctgaagaatttgcacatagtattcgctcaatttttgcaaatgtagaa
gccaaacttggagaaccttctgaaattgaccagagagacaagtatgttggaatttgtgga
ctctttgtactgcactttcaaatttttcgaactgttgataaaaagttttataagtcttta
ttggacatttgtaagaaggtaccagccatcactctcactgctaatattatttggtttcct
gataattttctgatccagagaataccagcagctgccaaacttctagacagaaaaagtctt
caagccattaaaatgcacagggatactttcctacagcagaaagctcagtcacttactaaa
gatgtgcagtcttactacgtctttgtgagctcatggatgatgaaaatggagtctatctta
tctaaagagcagaggatggataaatttgctgaagacctcaccaatagatgtaatattttt
atacagggcttcttatatgcatatagcattagtaccattattaaaaccacaatgaatctc
tacatgtcattacaaaaaccaatgaccaaaacttcagttaaggcattatgcagacttgtt
gaacttcttaaggcaatagagcatatgttctacaggagaagcatggttgtggctgattca
gtttcacatattacacagcaccttcagcatcaggctcttaattccatttctgtggccaag
aaaagagtaatttcggacaaaaaatacagtgaacagcgtcttgatgtgctctctgctcta
gttttggctgaaaacactctgaatggaccaagcacaaagcaacgacgacttattgtttcc
ttggcgctaagtgttggcacacagatgaaaacatttaaagatgaagaactcttgcccctt
caagtagttatgaagaaactggatcttatcagtgaactcagagaacgagtccagacgcag
tgtgactgttgttttttatactggcatcgagctgtcttcccaatttatttagatgatgtg
tatgaaaatgctgtagatgcagccagattacattacatgttcagcgcgttacgtgactgt
gtacctgctatgatgcatgcaaggcatttagagtcctgtgagatactcctggattgctac
gacaaggagattatggaaattttaaatgagcatttgctggacaagttgtgcaaagaaata
gagaaggatctgcgcctttctgtgcatactcatttaaagctggatgaccggaaccctttc
aaagttggcatgaaagacctggccctttttttctctctgaatccaattcggtttttcaat
cgtttcattgacattcgcgcttatgtaacccactacctagataagactttctacaatctg
acaacagtagctcttcatgactgggccacatacagtgaaatgagaaacttagctactcag
cgctatggattggttatgacagaggcacatcttcctagtcagactttggaacagggcctc
gatgttttggaaattatgagaaacattcatatatttgtatctcgatacctctacaatctc
aataatcagatttttattgaacgaacaagcaataataagcacttgaatactattaacatt
cggcatattgctaattcaattcgaacacatggcaccggaatcatgaatacaacagttaat
ttcacctaccagtttttgaaaaagaagttttatatatttagccaatttatgtatgatgaa
catatcaaatccagattgattaaagatattcggttttttagggaaatcaaggaccaaaat
gatcataagtatccttttgatagagcagaaaaattcaatcgaggtatcagaaaacttgga
ataacaccagaaggacagagttaccttgatcagttcaggcaactcatcagccaaattggt
aatgctatgggctatgtacgaatgataagatctggtggtcttcactgtagcagcaatgcc
attagatttgtgcctgatctcgaagatattgtaaattttgaagaactggtaaaagaagaa
ggtcttgcagatgaaacattaaaagcagcaaggcacttggattcagtcctcagtgaccac
acacgaaattctgctgaaggtacagaatatttcaaaatgcttgtagatgtttttgctcca
gaatttcgaaggcctaagaacatacatctccgaaatttttatatcattgttccccctctg
accctcaactttgtagagcattccattagttgcaaggagaaattaaataaaaaaaaaaaa
attggagctgcctttactgatgatggctttgccatgggtgtggcttacattctaaagctt
ttggatcagtatcaggagttcgactcacttcactggttccagtctgttagggagaaatac
ctgaaggagataagagcagttgctaagcaacagaatgtgcagtcagccagtcaagatgaa
aaactgctgcaaaccatgaatctcactcagaagcggctggatatctatctgcaggaattt
gagttgctttatttctcactgagcagtgcaagaattttcttcagagcagacaagactgca
gctgaagaaaaccaagagaagaaggagaaggaagaagaaactaaaacaagcaatggagac
ctgcccgacagcactgtgtctgctgagccggttgtgaaatga

DBGET integrated database retrieval system