KEGG   Oryctolagus cuniculus (rabbit): 100355504
Entry
100355504         CDS       T03373                                 
Symbol
UBE2O
Name
(RefSeq) ubiquitin conjugating enzyme E2 O
  KO
K10581  ubiquitin-conjugating enzyme E2 O [EC:2.3.2.24]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100355504 (UBE2O)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100355504 (UBE2O)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.24  (E3-independent) E2 ubiquitin-conjugating enzyme
     100355504 (UBE2O)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100355504 (UBE2O)
SSDB
Motif
Pfam: UQ_con SR-25 Tlp
Other DBs
NCBI-GeneID: 100355504
NCBI-ProteinID: XP_008249131
Ensembl: ENSOCUG00000014518
LinkDB
Position
Un
AA seq 1288 aa
MADPAARSARSSPLPPRRQAPAPEAAPAPVAAPAPASAPAAGPDSTSGPSSDSGPEAGSQ
RLLFSHDLVSGRYRGSVHFGLVRLIHGEDSDSEGEEDGRGSSGCSEAGGAGHEEGRASPL
RRGYVRVQWYPEGVKQHVKETKLKLEDRSVVPRDVVRHMRSTDSQCGTVIDVNIDCAVKL
IGTNCIIYPVNSKDLQHIWPFMYGDYIAYDCWLGKVYDLKNQIILKLSNGARCSMNTEDG
AKLYDVCPHVSDSGLFFDDSYGFYPGQVLIGPAKIFSSVQWLSGVKPVLSTKSKFRVVVE
EVQVVELKVTWITKSFCPGGTDSVSPPPSVITQENLGRVKRLGCFDHAQRQLGERCLYVF
PAKVEPAKIAWECPEKNCAQGEGSMAKKVKRLLKKQVVRIMSCSPDTQCPRDHSVEDPDK
KGEAKAKSEAASASPEETPDGSASPPGTQDEGAEEPPEAGEQLPPFLLKEGGDDRLHSAE
QDADDEAADDTDDTSSVTSSASSTTSSQSGSGTGRKKSIPLSIKNLKRKHKRKKNKITRD
FKPGDRVAVEVVTTMTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKRVQS
CPDPAVYGVVQSGDHIGRTCMVKWFKLRPSGDDVELIGEEEDVSVYDIADHPDFRFRTTD
IVIRIGNAEDGAPHKEDEPSVGQVARVDVSSKVEVVWADNSKTIILPQHLYNIESEIEES
DYDSVEGSTSGASSDEWEDDSDSWETDNGLVEDEHPKIEEPPIPPPEQPAAPEEEKGVVI
SEEAATAAIQGAVAMATPMAGLMEKAGKEGPPRSFRELKEAIKILESLKNMTVEQLLTGS
PTSPTVEPEKPTREKKFLDDIKKLQENLKKTLDNVAIAEEEKMEAAADAERREDKPEWPS
ETPVLCQQCGGKPGVTFTSAKGEVFSVLEFAPSNHSFKKIEFQPPEAKKFFSTVRKEMAL
LATSLPDGIMVKTFEDRMDLFSALIKGPTRTPYEDGLYLFDIQLPNIYPAVPPHFCYLSQ
CSGRLNPNLYDNGKVCVSLLGTWIGKGTERWTSKSSLLQVLISIQGLILVNEPYYNEAGF
DSDRGLQEGYENSRCYNEMSLIRVVQSMTQLVRRPPEVFEQEIRQHFSTGGWRLLNRIES
WLETHALLERAQGLPNGVPKDRSSPEPPAVAEPSDSGREEPEDGGLAPGEASQGSDSEGG
AQGLAPARRDHTDQAPEAAPDASVPPSVKPKKRRKSYRSFLPEKSGYPDIGFPLFPLSKG
FIKSVRGVLTQFRAALLEAGLPESTGDK
NT seq 3867 nt   +upstreamnt  +downstreamnt
atggcggatcccgcagcccgcagcgcccgcagctccccgctcccgcccaggcgccaagcc
ccagctccggaggcggccccggccccggtcgcagcccctgccccggcgtcggcgccggcc
gccgggccggactcgacctccgggccctcctccgactccggccccgaagccggctcgcag
cgtctgctgttctctcacgacctggtgtcgggccgctaccgcggctcggtgcacttcggg
ctggtgcgcctcatccacggcgaggactcggactccgagggcgaggaggatggccgcggc
agctcgggctgctcggaggcgggcggcgccggccacgaggagggccgggccagcccgctg
cgccgcggctacgtgcgcgtccagtggtacccggagggcgtcaagcagcacgtgaaggag
accaagctgaaactggaggaccgctccgtcgtgcccagggacgtggtcaggcacatgcga
tccaccgacagtcagtgtggcaccgtgatagacgtcaacattgactgcgccgtcaagctc
atcggcaccaactgcatcatctacccagtcaacagcaaggacctgcagcacatctggccc
ttcatgtacggggactacattgcctacgactgctggctggggaaggtctatgacctgaag
aaccagatcatcctgaagctctccaatggcgccaggtgctccatgaacacggaagatggt
gccaagctctacgatgtgtgcccgcacgtcagcgactcgggtctcttctttgacgactcc
tacggcttctacccgggccaggtgctcatcggccccgccaagatcttctccagcgtgcag
tggctgtcaggggtcaagcctgtgctgagcaccaagagcaagttccgcgtggtggtggaa
gaggtgcaggtcgtggagctgaaagtcacatggatcaccaagagtttctgtccagggggc
acagacagcgtcagccccccgccctctgtcatcactcaggaaaacctaggcagggtgaag
cgtctcggctgctttgaccatgctcagcggcagctcggggagcgctgtctgtacgtcttc
ccagccaaggtagagccggccaagattgcctgggagtgtccggaaaaaaactgcgcccag
ggggagggctctatggccaagaaggtaaagcgcctactgaagaagcaggtcgtgcgcatc
atgtcctgctccccggacacccagtgtccccgcgaccattccgtggaggacccagacaag
aaaggggaggccaaagccaagagtgaggcggcgtcagccagccccgaggagacccccgac
gggtccgccagcccgccggggacgcaggatgagggcgcggaggagccgcccgaggctggc
gagcagctgccccccttcctgctgaaggaaggcggggacgacaggctgcactcggcggag
caggacgcggacgacgaggccgccgacgacacggatgacaccagctccgtgacctcctcc
gccagctccaccacctcctcccagagcggcagcggcaccggtcgcaaaaagagcatcccc
ttgtccatcaagaacctaaagcgaaaacacaagaggaagaagaataaaatcactcgggac
ttcaaaccgggggacagggtggcggtggaggtggtgaccacgatgacctcggccgacgtg
atgtggcaggacggctccgtggagtgcaacatccgctccaacgacctcttccccgtgcac
cacctggacaacaacgagttctgccctggagacttcgtggtggacaagcgagtccagagc
tgtccagaccctgcggtttacggcgtggtgcagtctggggaccacattggccgcacctgc
atggtgaagtggttcaagctgcggccaagtggggatgacgtggagctgatcggggaagag
gaagacgtgagcgtttacgacattgccgaccaccccgacttccgcttccgcaccactgac
atcgtcatccgcattggcaatgccgaggatggggctcctcacaaggaggacgagccgtca
gtgggccaagtggcccgtgtggacgtcagcagcaaggtggaggtggtgtgggccgacaac
tcaaagaccatcatcctgccccagcacctgtacaacattgagtctgagatcgaagagtca
gactacgactccgtggagggcagcaccagtggcgcgtcctcggacgagtgggaagatgac
agcgacagctgggagacagacaacgggctggtggaggatgagcaccccaagatagaggag
ccccccatcccgccccccgagcagccagcggcccccgaggaggagaagggggtggtgatc
agcgaagaggctgccacggccgccatccagggggccgtggccatggccacccccatggca
gggctgatggagaaggctggcaaggaggggcccccccggagcttccgggagctgaaggag
gccatcaagatcctggagagcctgaagaacatgaccgtggagcagctgctgaccggctcg
cccacctcgcccaccgtggagcccgagaagcccacccgggagaagaagtttctggacgac
atcaagaaactgcaggagaacctcaagaagacgctggacaacgtggccatcgcagaggag
gagaagatggaggcggcggccgacgccgagcgcagggaggacaagcccgagtggcccagc
gagaccccggtgctgtgccagcagtgcggcggcaagcccggggtcaccttcaccagcgcc
aagggcgaggtcttttccgtgctggagttcgcgccctcaaatcattcttttaagaaaatt
gagttccagcccccagaagccaagaagttcttcagcacggtgcggaaggagatggcgctg
ctggctacctcactgcccgacggcatcatggtcaagaccttcgaggaccgaatggacctc
ttctccgccctcatcaagggccccacgcgaaccccctatgaggacggcctctacctgttt
gacatccagctccccaacatctacccggccgtgcccccccacttctgctacctctcccag
tgcagtgggcgcttgaaccccaacctgtatgacaacgggaaggtgtgcgtcagcctcctg
ggcacctggatcggcaaggggacagagaggtggacgagcaagtccagccttctccaggtg
ctcatctccatccaagggctgatcctggtgaacgagccctactacaacgaagccggcttc
gacagcgaccggggcctgcaggaaggctacgagaacagccgctgctacaacgagatgtcg
ctgatccgggtggtgcaatccatgacccagctggtgcggcggccgcccgaggtcttcgag
caggagatcaggcagcacttcagcaccggcggctggcggctgctgaaccgcatcgagtcc
tggctggagacccacgcgctgctggagagggcccaggggctgcccaatggggtgcccaag
gaccgaagctccccggagccaccggccgtggctgagccctcggactcgggccgagaagaa
cctgaggatggagggctggcccctggagaggcctcccagggctcagactcggaaggtggc
gcccagggcctggccccagctcgcagggaccacacagaccaggctcccgaggccgcgcca
gacgcgtccgtgccacccagcgtaaaaccaaagaagcggagaaagagctaccggagcttc
ctgcccgagaagagcggctaccctgacatcggcttccccctcttcccgctgtccaagggt
ttcatcaagagcgtccgaggggtcctgacgcagttccgggcggccctgctggaggcgggc
ctgcccgagagcactggggacaagtag

DBGET integrated database retrieval system