KEGG   Oryctolagus cuniculus (rabbit): 100355560
Entry
100355560         CDS       T03373                                 
Symbol
DNAJC6
Name
(RefSeq) DnaJ heat shock protein family (Hsp40) member C6
  KO
K09526  DnaJ homolog subfamily C member 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355560 (DNAJC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ocu03041]
    100355560 (DNAJC6)
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100355560 (DNAJC6)
   04131 Membrane trafficking [BR:ocu04131]
    100355560 (DNAJC6)
Spliceosome [BR:ocu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100355560 (DNAJC6)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP40 / DNAJ
   100355560 (DNAJC6)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100355560 (DNAJC6)
SSDB
Motif
Pfam: PTEN_C2 DnaJ Y_phosphatase
Other DBs
NCBI-GeneID: 100355560
NCBI-ProteinID: XP_008263337
Ensembl: ENSOCUG00000010020
UniProt: G1SYE2
LinkDB
Position
13:complement(100963939..101159747)
AA seq 947 aa
MSLLGSYRKKTSNDGYESLQLVDSHGDFSAGSGAGGAKQRVSGGPAARSPARLPPDRAST
MDSSGASSPDMEPSYGGGLFDMVKGGAGRLFSNLKDNLKDTLKDTSSRVIQSVTSYTKGD
LDFTYVTSRIIVMSFPLDSVDIGFRNQVDDIRSFLDSRHLDHYTVYNLSPKSYRTAKFHS
RVSECSWPIRQAPSLHNLFAVCRNMYNWLLQNPKNVCVVHCLDGRAASSILVGAMFIFCN
LYSTPGPAVRLLYAKRPGIGLSPSHRRYLGYMCDLLADKPYRPHFKPLTIKSITVSPIPF
FNKQRNGCRPYCDVLIGETKIYSTCTDFERMKEYRVQDGKIFIPLNITAQGDVIVSMYHL
RSTIGSRLQAKVTNTQIFQLQFHSGFIPLETTVLKFTKPELDACDVPEKYPQLFQVTLDI
EVQPHDKVIDLTPPWEHYCTKDVNPSILFSSHQEHQDTLVLGGQPPIDIPPDNPRHFGQG
GFFASLCWQDQKSEKSFCEEDHAALVNQESEQSDDELLTLSSPHGNANGDKHHGAKKPSK
KQQEPAVPPPPEEVDLLGLEGSEVSKNFSPPAAPPTNSELLSDLFGGGGAAGLAQAGQSG
VEDVFHASGPASAQSTPRRSATSTSASPTLRVGEGATFDPFGAPSKPAGQDLLGSFLNTS
SASSDPFLQPTRSPSPTVHGGFGMGSKSAATSPTGSSHGTPTHQNKPQTLDPFADLGTLG
SSSFASKPTTPTGLGGGFPPLSSPQKASPQPMGGGWQQGGGYSWQQSQSKPQSSMPHSSP
QNRPNYNVSFSAVPGGQNERGKGSANLEGKQKAADFEDLLSSQGFNAHKDKKGPRTIAEM
RKEEMAKEMDPEKLKILEWIEGKERNIRALLSTMHTVLWAGETKWKPVGMADLVTPEQVK
KVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFENQGQKPLY
NT seq 2844 nt   +upstreamnt  +downstreamnt
atgagcctcctcgggagctaccggaaaaagaccagcaacgatggttatgaatctttgcag
ctggtggacagtcacggggacttcagtgcgggcagcggcgccggtggcgccaagcagaga
gtgagcggcggcccggcggcacgcagtcccgcgcggctgcctccggaccgcgccagcacc
atggacagctcaggtgcctcttctccagacatggagcccagctacgggggaggtctcttt
gacatggtgaaaggaggcgcagggagactctttagtaacctcaaggacaacctgaaggac
acccttaaggatacatcatctagagttatacagtctgtgaccagctatacgaagggagat
ttagacttcacttacgtaacctccagaattattgtgatgtcctttcctctggacagtgtt
gacataggattcaggaatcaggtagatgacattcgaagctttctggactccagacatctt
gaccactacacagtctacaacctgtcgcctaagtcttatcgaaccgccaagtttcacagc
cgggtctcagaatgcagctggcccattaggcaggcccccagtctgcacaacctctttgcc
gtgtgtcggaatatgtacaactggctactgcagaatcccaaaaacgtctgtgttgtccac
tgcttggatggacgagcagcctcgtcaattctggttggtgctatgttcattttctgtaat
ctctactcaactcctggcccagctgttcgattgttgtatgcaaagcgaccaggaattgga
ctttcaccatcccataggagatacctgggctatatgtgtgaccttctagctgacaaaccc
taccgccctcacttcaagcctctcacgattaagtcgatcactgtcagtccaatacctttt
tttaacaagcagagaaatgggtgtcgtccttattgtgatgtgctgattggagaaaccaaa
atatattcgacctgcacagattttgaacgaatgaaagaataccgtgttcaagatggaaaa
atattcattcccttgaacatcactgctcaaggagatgtgattgtttccatgtatcacttg
aggtcaaccatcgggagccggctgcaggcaaaggtgaccaacacacagatattccagctg
cagtttcatagtgggttcatcccactggaaacaacagtcttgaagttcaccaagcctgag
ttagatgcatgtgatgtaccagaaaagtatcctcagctatttcaggtgacactggatata
gaagtacagccccatgacaaagtgatagacttaaccccaccatgggagcattactgcaca
aaagatgtcaaccccagcatcctcttctcttctcaccaggagcatcaagatactctggtc
ttgggaggacagcctccaatagatatccctccagacaaccccaggcattttgggcaaggt
ggcttttttgcctctctctgttggcaagatcagaaatcggagaaatcattctgtgaagag
gaccacgctgccctagtgaatcaggaaagtgagcagtcggacgacgaacttctgaccctt
tctagtcctcatggtaatgccaatggtgacaaacatcatggagccaagaagcccagcaaa
aagcagcaggagccagctgtccccccacccccagaggaggtggatctgctgggcctagag
gggtcggaagtgagtaagaacttctctccgccggcggctcctcccaccaattctgaactg
ctgagtgacctgtttgggggcggaggtgcagctggtcttgcccaggctggacagtcaggg
gtggaagacgtgtttcatgctagtggacctgcatccgcccagtcaacaccacgccgctct
gccacttccacctctgcatctccaaccctaagagtgggagaaggtgccacctttgatcca
tttggtgcaccttctaagcctgcaggtcaagatttgctgggttcttttctgaacacttcc
agtgcttctagtgacccctttcttcagcccacaagaagtccttcacctacagtgcatgga
ggctttggaatgggaagcaaatcagctgccaccagcccaacagggtcctcacacggcact
cccacccatcaaaacaaacctcagactctggatccttttgctgaccttgggacactaggt
agttcttcattcgccagcaaacccaccaccccaactggattaggtggaggatttccacct
ctgagctcaccacagaaagcgtctccccagcccatgggtggagggtggcaacagggaggt
ggctacagctggcagcagtcgcagtccaagccacagtccagcatgcctcactcctcgccc
cagaaccgacccaactacaacgtgagcttctcagccgtgcctggaggccagaacgaacgt
gggaaaggatcagctaacttggaaggaaaacaaaaagcagctgattttgaagacctgctc
tccagtcaaggtttcaatgctcacaaagacaaaaagggtcctcgaacaatagctgagatg
aggaaggaagaaatggccaaggagatggaccctgagaaattgaagattctggaatggatt
gaaggcaaagagagaaatatcagagctcttctctctacgatgcacaccgtgctgtgggct
ggggagaccaagtggaaaccagttggcatggcagacctggtaacaccggagcaggtgaag
aaggtgtacaggaaggcagtgctggttgtgcacccagataaagctactgggcaaccctat
gaacaatatgcaaagatgattttcatggagctgaatgatgcctggtctgaatttgagaac
caaggccaaaagcccttgtattaa

DBGET integrated database retrieval system