KEGG   Oryctolagus cuniculus (rabbit): 100356102
Entry
100356102         CDS       T03373                                 
Symbol
PTTG1
Name
(RefSeq) pituitary tumor-transforming 1
  KO
K06635  securin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100356102 (PTTG1)
   04114 Oocyte meiosis
    100356102 (PTTG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356102 (PTTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356102 (PTTG1)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    100356102 (PTTG1)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 100356102
NCBI-ProteinID: XP_002710398
Ensembl: ENSOCUG00000014877
UniProt: G1T8A3
LinkDB
Position
3:41834441..41840482
AA seq 201 aa
MATLIFVDKENGEPGTLVAPKDGLKLGSGPSAKALEGRAQVSAPLVGKRFDGPPALPKAA
RKALGTVNRAIEKSVKTNGPLKQKQSSAAKKITEKNVKAKNPVPASDDTYPEIEKFFPFN
PLDFESFDLPEEHQVAHLPLNGVPLMIIDEQRELEKLLQLGPPTPVKMASTPWEAGPLPS
PSSILSALDVDLPPVCYDMDI
NT seq 606 nt   +upstreamnt  +downstreamnt
atggctactctgatctttgttgataaggaaaacggagaacctggcaccctcgtggctcct
aaggatgggctgaagctggggtctgggccttcagcgaaagccttagaggggagagcgcag
gtttcagcgccgcttgttggcaaaaggtttgatggtccaccagccttaccgaaagctgcc
agaaaggccttgggaactgtcaacagagctatagaaaagtccgtgaagacgaatggaccc
ctcaaacaaaaacagtccagcgctgccaaaaagataactgagaagaatgttaaagcaaaa
aaccctgttcctgcctcagatgacacctatccagaaatagaaaaattttttcccttcaat
cctctagattttgagagctttgacctgcctgaagagcaccaggtcgcacacctgcccttg
aacggagtgcctctcatgatcatcgatgagcagagagagcttgagaagctgttgcagctg
ggcccccctacgccggtgaagatggcttctactccatgggaggctggtccgttgccatct
ccttcaagcatcctgtcggccctggatgttgacctgccacctgtgtgttacgatatggat
atttga

KEGG   Oryctolagus cuniculus (rabbit): 100356870
Entry
100356870         CDS       T03373                                 
Name
(RefSeq) securin-like
  KO
K06635  securin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100356870
   04114 Oocyte meiosis
    100356870
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356870
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ocu03036]
    100356870
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    100356870
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 100356870
NCBI-ProteinID: XP_002710740
Ensembl: ENSOCUG00000003392
LinkDB
Position
3:complement(110241538..110242278)
AA seq 200 aa
MATLIFVDKENREPGTLVAPKDGLKLGSGPSKALEGRAQVSAPLVSKRFDGPPALPKAAR
KALGTVNRAIEKSVKTNGPLEQKQSSAAKKITEKNVKAKNSVPASDDTYPEIEKFFPFNP
LDFESFDLPEEHQVAHLPLNGVPLMILDEQRELEKLLQLGPPTPVKMASTPWEAGPLPSP
SSILSALDVDLPPVCYDMDI
NT seq 603 nt   +upstreamnt  +downstreamnt
atggccactctgatctttgttgataaggaaaacagagaacctggcaccctcgtggctcct
aaggatgggctgaagctggggtctgggccttcgaaagcgttagaggggagagcgcaggtt
tcagcgccgcttgttagcaaaaggtttgatggtccaccagccttaccgaaagctgccaga
aaggccttgggaactgtcaacagagctatagaaaagtccgtgaagacgaatggacccctc
gaacaaaaacagtccagcgctgccaaaaagataactgagaagaatgttaaagcaaaaaac
tctgttcctgcctcagatgacacctatccagaaatagaaaaattttttcccttcaatcct
ctagattttgagagctttgacctgcctgaagagcaccaggtcgcacacctgcccttgaac
ggagtgcctctcatgatcctcgacgagcagagagagcttgagaagctgttgcagctgggc
ccccctacgccagtgaagatggcttctactccatgggaggctggtccgttgccatctcct
tcaagcatcctgtcggccctggatgttgacctgccacctgtgtgttacgatatggatatt
taa

DBGET integrated database retrieval system