KEGG   Oryctolagus cuniculus (rabbit): 100356422
Entry
100356422         CDS       T03373                                 
Symbol
PPARA, PPAR, PPAR-ALPHA
Name
(RefSeq) peroxisome proliferator activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03320  PPAR signaling pathway
ocu04024  cAMP signaling pathway
ocu04920  Adipocytokine signaling pathway
ocu04922  Glucagon signaling pathway
ocu04931  Insulin resistance
ocu04932  Non-alcoholic fatty liver disease
ocu04936  Alcoholic liver disease
ocu05160  Hepatitis C
ocu05207  Chemical carcinogenesis - receptor activation
ocu05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100356422 (PPARA)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100356422 (PPARA)
   04920 Adipocytokine signaling pathway
    100356422 (PPARA)
   03320 PPAR signaling pathway
    100356422 (PPARA)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100356422 (PPARA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100356422 (PPARA)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100356422 (PPARA)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100356422 (PPARA)
   04932 Non-alcoholic fatty liver disease
    100356422 (PPARA)
   04931 Insulin resistance
    100356422 (PPARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100356422 (PPARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ocu03310]
    100356422 (PPARA)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100356422 (PPARA)
Nuclear receptors [BR:ocu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   100356422 (PPARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100356422
NCBI-ProteinID: XP_002723400
Ensembl: ENSOCUG00000009353
UniProt: A0A5F9CZD5
LinkDB
Position
Un
AA seq 468 aa
MVDTGSPLCVLSALDADDLESPLSEEFLQEMGNIHEISQSIGEDSSGSFSFPEYQCLGSC
SGSDGSVITDTLSPASSPSSVTCPVVPGGVDEYPSGALNIECRICGDRASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKILKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAESLACEQDAEGPGGADLRSLARRIYEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGIQNKEAEVRIFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLVAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGSIEKMQEGIVHVLRLHLQSNHPDDT
FLFPKLLQKMADLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggtggacacgggaagcccgctctgcgttctctctgccctcgatgccgatgacctggaa
agcccgttatctgaagagttcctccaggaaatggggaacatccatgagatttcacaatcc
attggtgaggacagctctggaagcttcagttttccggaataccagtgtctgggcagctgc
tccggatcagatggctccgtgatcacagacaccctttcacccgcgtccagtccctcatca
gtcacctgtcccgtggttcctggtggcgttgatgaatatcccagcggagccctcaacatt
gaatgcaggatctgtggtgacagggcctcaggctaccactacggggtccatgcatgtgaa
ggctgcaagggcttcttccggcgaacgattcggctaaagctggtgtacgacaaatgcgac
cgcagctgcaagattctgaagaagaatcgcaacaagtgccagtactgccgctttcacaag
tgcctttccgtggggatgtcccacaatgcgattcgcttcggccgcatgccgcgatcggag
aaggcgaagctgaaagccgagagccttgcgtgcgagcaggacgccgagggccccggcggc
gccgacctcaggtccctggcccggaggatctacgaggcctacctgaagaacttcaacatg
aacaaggtcaaagcccgcgtcatcctcgcggggaagaccagcaacaacccgccctttgtc
atacacgacatggagacgctgtgtatggctgagaagacgctcgtggccaagatggtggcc
aatggcatccagaacaaggaggcggaggtccgcatcttccactgctgccagtgcatgtcg
gtggagaccgtcacagagctcaccgagttcgccaaggccatcccgggcttcgcaaacttg
gacctgaatgatcaagtgaccttgctcaaatacggagtttatgaggccatattcacgatg
ctgtcgtcgctgatgaacaaagatgggatgctggtcgcctacgggaatggttttatcacg
cgggagttcctaaaaaacctgaggaaaccgttttgtgatatcatggaacccaagtttgac
ttcgccatgaagttcaacgcactggagctggacgacagtgacatttccctttttgtggct
gctatcatctgctgtggagatcggcccggcctcctaaacataggatccattgagaagatg
caggagggcatcgtgcacgtgctgaggcttcacttgcaaagcaaccacccggacgacacc
ttcctcttccccaaactcctccaaaagatggcagacctgcggcagctggtcacggagcac
gcgcagctggtgcaggtcatcaagaagacggagtcggacgcggcgctgcacccgctgctg
caggagatctacagggacatgtactga

DBGET integrated database retrieval system