KEGG   Oryctolagus cuniculus (rabbit): 100356658
Entry
100356658         CDS       T03373                                 
Symbol
RGS3
Name
(RefSeq) regulator of G-protein signaling 3
  KO
K07524  regulator of G-protein signalling 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100356658 (RGS3)
SSDB
Motif
Pfam: RGS PDZ PDZ_6 Peptidase_M50 PDZ_2
Other DBs
NCBI-GeneID: 100356658
NCBI-ProteinID: XP_008271630
Ensembl: ENSOCUG00000008240
UniProt: A0A5F9DNK0
LinkDB
Position
Un
AA seq 887 aa
MNRFNGLCKVCSERRYRQITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTV
LQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSAHDLQS
PPNKREKNCTHGAQARPEQRHSCHLVCDSSDGLLLGGWERYTEVTKRGGQHTLPALSRAT
APTDPNYIILAPLNPGSQLLRPVYQEDTIPEEESGTPSKGKSSTGLGKKSRLMKTVQTMK
GHGNYQNCPVLRPHAPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEG
RNKAAQVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKA
ECLFTLEAHSQEQKKRVCWCLAENIAKQQQLATSPLQSKMFETEADEKREMPSAEGKGPA
AEAPPPSKDPSSGQEPPPEPEPPLSQDPPSRDAPTCTEPTPEQEAPLSKNATPCQEPPLA
QDPPPCGDLSAGQEPPPSQDALLSKDIPAIRDPPSCQGLPPSPPLLAETTGTGDPPAAPG
APPAVSRPAFVIPEVRLDSAYSHRAGAERGSSGEEEEDAEEAEEGEEGEEDEEEDTSDDN
YTERSEAKRSSMIETGPGAEGGLSLRVQNSLRRRTHSEGSLLQEARGPCFSSDTTLHCSD
GEGAASSWAIPSPRTLKKELGRNGGSMHHLSLFFTGHRKMSGDDDEASRKRKSKNLAKDM
KTKLGIFRRRNESPGAQPAGKADKMMKSFKPTSEEALKWSESLEKLLLHKYGLAVFQAFL
RTEFSEENLEFWLACEDFKKVKSQSKMAAKAKKIFAEYIAIQACKEVNLDSYTREHTKDN
LQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLIQQKKMSPPL
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgaaccgcttcaatgggctctgcaaggtgtgctcggagcgccgctaccgccagatcacc
atcccgcgggggaaggacggcttcggcttcaccatctgctgcgactctcctgtccgagtg
caggctgtggattctgggggcccggcggagcgggcagggctgcagcagctggacacggtg
ctgcagctgaatgagaggcctgtggagcactggaaatgtgtggagctggcacacgagatc
cggagctgccccagtgagatcatcctcctagtgtggcgcatggtcccccaggtcaagcca
gggccagatggcggagtcctgcggcgcgcctcctgcaagtcggcacatgacctccagtca
ccccctaacaagcgggagaagaactgcacccatggagcccaggcgcggcctgagcagcgc
catagctgccacctggtgtgtgacagctctgatgggctgctgctcggcggctgggagcgc
tacaccgaggtgaccaagcgcgggggccagcacaccctgcctgccttgtcgcgtgccacc
gcccccaccgaccccaactatatcatcctggccccgctgaaccctgggagccagctgctg
cggcccgtgtaccaggaggacaccattcctgaagaagaatcaggcactcccagtaaaggg
aagtcctccacaggcctggggaagaagtcccggctgatgaagacggtgcagaccatgaag
ggccacgggaactaccagaactgcccggtcctgaggccgcatgccccgcactccagctac
ggcacctacgtcaccctggcccccaaggtgctggtgttccccgtctttgttcagccgctc
gatctctgcaaccctgcccggaccctcctgctctcagaggagctgctgctgtacgagggg
aggaacaaggctgcccaggtaaccctgttcgcctactcggacctgctgctcttcacgaag
gaggatgagcctggccgctgcaacgtcctgaggaaccccctgtacctccagagcgtgaag
ctgcaggaaggctcttctgaggacctgaaattctgtgtgctgtacctggcagagaaggca
gagtgcttattcactttggaggcacactcacaggagcagaagaagagagtgtgctggtgc
ctggcagagaacatcgccaagcagcaacagctggccacctcgcccctgcagagcaagatg
tttgagaccgaggcagatgagaagagggagatgccctcagctgaagggaaggggccggct
gccgaggcccccccacccagcaaggacccctcttctggccaggagcctcctccagagcca
gagccacccctcagccaggacccgcccagcagagatgcacccacctgcacggaacccact
ccggagcaagaagccccgttgagcaagaatgccacgccatgccaggaaccgcctctggcc
caggaccccccaccctgcggtgacctatctgctggccaagagccccctcccagccaggat
gctctactcagcaaagacatccctgccatcagagaccccccgtcctgtcaaggcctgcct
cccagccctcctctgctggctgagaccacgggcacaggggaccccccagcggcccccggg
gccccgcctgccgtctccaggcccgcctttgtgatccccgaggtccggctggatagcgcc
tatagccacagggcaggtgccgagaggggcagctcaggagaggaggaggaggatgcagaa
gaggcagaggagggcgaggaaggggaggaagacgaggaggaggacacgagcgatgacaac
tacacggagcgcagcgaggccaagcgcagcagcatgatcgagacaggcccgggggccgag
ggcggcctctcgctgcgggtgcagaactcactgcggcgccggacgcacagcgagggcagc
ctgctgcaggaggcccgcgggccctgcttctcctcggacaccaccttgcactgctcggac
ggcgagggcgccgcgtcctcctgggccatcccttcaccccgcaccctcaagaaggagctg
ggccgcaatgggggctccatgcaccatctgtccctcttcttcacggggcacaggaagatg
agtggggatgatgacgaggcctcccggaagagaaagagcaaaaacctagccaaggacatg
aagaccaagctgggcatcttcaggaggcggaacgagtcccctggggcccagccggcgggc
aaggcagacaaaatgatgaagtcattcaagcccacctcggaggaagccctcaagtggagc
gagtccttggagaagctgctgcttcataaatatggcttagccgtgttccaggccttcctc
cgcacggagtttagcgaggagaacctggagttctggctggcttgtgaggacttcaagaag
gtcaagtcgcagtccaagatggcagccaaagccaagaagatctttgctgaatacatcgcg
atccaggcgtgcaaggaggtcaacctggactcgtacacgcgggagcacaccaaggacaac
ctgcagagcgtcacgcgtggctgcttcgacctggcccagaagcgtatctttgggctcatg
gaaaaggactcgtacccccgcttcctccgctctgacctctacctggacctcattcagcag
aagaagatgagtcccccgctttag

DBGET integrated database retrieval system