KEGG   Oryctolagus cuniculus (rabbit): 100357978
Entry
100357978         CDS       T03373                                 
Name
(RefSeq) EH domain-containing protein 1
  KO
K12483  EH domain-containing protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100357978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100357978
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100357978
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100357978
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100357978
SSDB
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU Roc Gtr1_RagA AAA_28 TsaE AIG1 AAA_16 EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 100357978
NCBI-ProteinID: XP_008251915
LinkDB
Position
Un
AA seq 549 aa
MLEPGTAAASTVSGSMFSWVSKDARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEF
HSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPS
EGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRI
SRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIE
TQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSL
PRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKXSKKKELVNNLGEIYQKIERE
HQISPGDFPSLRKMQEQLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVLVRQEESLMP
SQVVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGA
SAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHL
VPPSQRRHE
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgttagagccggggaccgccgccgccagcaccgtgtccggcagcatgttcagctgggtc
agcaaggatgcgcggcgcaagaaggagccggagctgttccagacggtggccgagggcctg
cggcagctgtacgcgcagaagctgctgccgctggaggagcactaccgcttccacgagttc
cactcgcccgcgctggaggacgcggacttcgacaacaagcccatggtgctgctcgtgggc
cagtacagcacgggcaagaccaccttcatccggcacctgatcgagcaggacttcccgggg
atgcgcatcgggcccgagcccaccaccgactcgttcatcgcggtcatgcacgggcccagc
gagggcgtggtgccgggcaacgcgctcgtcgtggacccgcggcgccccttccgcaagctc
aacgccttcgggaacgccttcctcaacaggttcatgtgtgcccagctgcccaacccggtg
ctagacagcatcagcatcatcgacacccccggcatcctgtccggagagaagcagcgcatc
agcagaggctacgacttcgcggccgtcctcgagtggttcgccgagcgcgtggaccgcatc
atcctgctcttcgacgcccacaagctggacatctcggacgagttctcggaggtcatcaag
gccctcaagaaccacgaggacaagatccgcgtggtgctcaacaaggccgaccagatcgag
acgcagcagctgatgcgcgtctacggcgccctcatgtggtcgctgggcaagatcatcaac
acgcccgaggtggtccgcgtctacatcggctccttctggtcccacccgctgctcatcccc
gacaaccgcaagctgttcgaggccgaggagcaggacctgttcaaggacatccagtcgctg
ccccgcaacgccgccctgcgcaagctcaacgacctcatcaagcgcgcgcggctggccaag
gtgcacgcctacatcatcagctctctcaagaaggagatgcccaacgtgttcggtaaatag
agcaagaagaaggagctggtgaacaacctgggcgagatctaccagaagatcgagcgggag
caccagatctcgccgggcgacttccccagcctccgcaagatgcaggagcagctgcagacg
caggacttcagcaagttccaggccctgaagcccaagctgctggacacggtggacgacatg
ctggccaacgacatcgcgcggctcatggtgctggtgcgccaggaggagtcgctgatgccc
tcgcaggtggtcaagggcggcgccttcgacggcaccatgaacgggcccttcgggcacggc
tacggcgagggtgccggcgagggcatcgacgacgtcgagtgggtggtgggcaaggacaag
cccacctacgacgagatcttctacacgctgtcgcccgtcaacggcaagatcacgggcgcc
agcgccaagaaggagatggtcaagtccaagctgcccaacacggtgctcggcaagatctgg
aagctggccgacgtggacaaggacgggctgctggacgacgaggagttcgccctggccaac
cacctcatcaaggtcaagctggagggccacgagctgcccgccgacctgccgccgcacctc
gtcccgccctcccagcggagacacgagtga

DBGET integrated database retrieval system