KEGG   Oryctolagus cuniculus (rabbit): 100358128
Entry
100358128         CDS       T03373                                 
Symbol
SPG20
Name
(RefSeq) spastic paraplegia 20 (Troyer syndrome)
  KO
K19366  spartin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358128 (SPG20)
SSDB
Motif
Pfam: Senescence MIT
Other DBs
NCBI-GeneID: 100358128
NCBI-ProteinID: XP_002720632
Ensembl: ENSOCUG00000017748
LinkDB
Position
Un
AA seq 672 aa
MEQEPQNGEPAEIEIIREAYRKAFLFVNKGLSTDESGQKEEAKSYYKQGIGHLLRGISIS
SSAAEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLRNDLQEVPKLYPEFPPK
DLCEKAPEPQPVSASQQAEVNGSASAAGAGSLALPAASSLPSQSCPAEAPPAYTPQAAEG
HYTVSYGTDSGEFSSVGEDFYRNHSQPPPLESLGLDADELILIPNGVQIFFVNPAGEVSA
PSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTVGAYMFPDTMLQ
AAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEGENEFQIPGRTRHPSDQL
KEASDTDVRQLGPTDQGSKDVRLKGKRGKKTKDTSSEEVNLSHIVPCEPVSEERAKELPE
WSEKVAQNILSGASWVSWGLVKGAEFTGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLY
IAKQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKRDKDGKSTLDGA
LVVAASSVQGFSTVWQGLECAARCIVNNVSAETVQTVRYKYGHNAGEATHHAVDSAINVG
VTAYNIDNIGIKAMVKKTAKQTGHTLLEDYHIVDNSEKENREGAANTTREEKDEQTEGTE
KKEAKKKVAKKK
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggaacaagaaccacaaaatggagagcctgctgaaattgagattatcagggaagcatac
aggaaggcctttttatttgtaaataaaggactgagtacagatgagtcaggtcagaaggag
gaagcaaagagttactataagcaaggaataggacacctactcagaggaatcagcatttca
tcatcagctgctgaacacacaggccctgggtgggaatctgccagacagatgcagcagaaa
atgaaagagactctacagaatgtacgcaccaggttggaaattctagagaaaggtcttgcc
acttctcttcggaatgatcttcaggaagtgcccaagttatatccagagtttccgcctaaa
gacctgtgtgagaaggcaccagagcctcagcccgttagtgcatctcagcaagctgaagta
aatggaagcgcttcggctgcaggggcagggtcccttgctctgcctgctgcttcatcctta
ccatctcagagttgtccagcagaagctcctcctgcttatacgccgcaggctgctgagggc
cactacacggtgtcctatgggacagattccggggagttttcatcagttggagaagacttc
tacaggaatcattctcagccgcctcctcttgagtccttagggctagatgcagatgagttg
attttgataccaaatggagtacagattttttttgtaaaccctgcaggagaggttagtgcg
ccttcatatcctgggtaccttcgaatcgtgaggttcttggataattctcttgatacagtt
ctgaaccgtcctcctgggtttcttcaggtttgtgactggttgtatcctctagttcctgat
agatctccagttctgaaatgcactgtgggagcttacatgtttcctgatacaatgctgcaa
gcagcaggatgctttgtaggggtcgtcttgtcctctgagctaccggaagatgatagagag
ctctttgaggatctgttaagacagatgtctgaccttcgactccaggccaactggaacaga
gcagaaggagaaaatgaattccagatccctggaagaacaagacacccttctgaccaactg
aaggaagcctctgatactgatgtgagacagttgggtcctacagaccaaggcagtaaggat
gtgcgtcttaaaggaaaacgtggaaaaaagactaaagatacttcaagtgaagaagttaat
ctgagtcacattgtaccttgtgagccagtttcagaagaaagagcaaaagaattacctgaa
tggagtgaaaaagtggctcaaaacattttgtcaggtgcttcctgggtgagttggggttta
gtcaaaggtgctgaatttactggcaaagcaatccagaaaggtgcttctaaactccgggaa
cgaattcaaccggaagaaaaaccagtggaagttagtccagctgtcaccaagggactttat
atagcaaagcaggcgacaggaggagcagcaaaagtcagtcagttcctagttgatggagtc
tgcacagtagcaaactgtgttggaaaagaactagctccgcatgtcaagaagcatggcagc
aaactcgtgccggaatcacttaagagagacaaagatggaaagtctaccctggacggtgct
ttggttgttgcagcaagtagtgttcaaggattttctactgtctggcaaggattggaatgt
gctgcaaggtgcattgttaacaatgtttcagcagaaactgtacaaactgtcagatacaaa
tacgggcataatgcaggagaagctacacaccatgcagtggattcggccatcaatgttggt
gtaactgcctataatattgacaacattggtatcaaagcaatggtgaagaaaactgcgaaa
caaacagggcacacgctcctcgaggactatcacatagttgataattctgagaaggaaaat
cgagaaggagcagcaaatacaacgagagaggagaaagatgagcagacggagggtacagag
aagaaagaggcaaagaagaaagtggcaaagaagaaataa

DBGET integrated database retrieval system