KEGG   Oryctolagus cuniculus (rabbit): 100358730
Entry
100358730         CDS       T03373                                 
Symbol
INHBE
Name
(RefSeq) inhibin beta E subunit
  KO
K22689  inhibin beta E chain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100358730 (INHBE)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358730 (INHBE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100358730 (INHBE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358730 (INHBE)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100358730 (INHBE)
SSDB
Motif
Pfam: TGF_beta Anti-TRAP
Other DBs
NCBI-GeneID: 100358730
NCBI-ProteinID: XP_002720955
Ensembl: ENSOCUG00000007382
UniProt: G1SSX9
LinkDB
Position
Un
AA seq 352 aa
MGLPDVQLCLVLLWTLGWARRAGSECPACGGPTLAPQAERAVVLELAKQQILEGLHLTSR
PRITHPPPPAALTTALRRLQPGSVAPGNGEEIVSFATVTDSSPAACSSMLTFHLPTPRSH
HLYRARLWLHVFPTSPGTLNLKIFRWSPRRRHRGSRTLLGEHQLSLPGWQALTLPPSGLR
GERSGVLKLQLDCRPLKGNRTAAGPPRQRLLDMAGHQRPFLELKMRANEPGAGRARRRTP
TCEPETPLCCRRDHYVDFQELGWRDWILQPEGYHLNYCSGQCPLHLAGSPGIAASFHSAV
FSLLKANNPWPAGTSCCVPTARRSLSLLYLDHKSNVVKTDVPDMVVEACGCS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggggctcccggatgtccagctctgcctggttctgctgtggacactggggtgggcacga
agggcaggatcggagtgccccgcctgtgggggcccaaccctggcaccccaggcagaacga
gctgtggtcctggagctggccaagcagcaaattctggaggggctgcacctgaccagccgg
ccaagaataacacatcctccacccccggcagcgctgaccacagccctccgaaggctccag
cctgggagcgtggctccagggaacggggaagaaattgtcagctttgctactgtcacagac
tcctcccctgcagcatgcagctccatgctcaccttccacctgcccacgcctcggtcccac
cacctgtaccgtgcccgcctctggctgcacgtgttccccacctctcctggcactcttaac
ttgaagattttccgatggagcccaaggaggaggcaccgaggatcccgcaccctcctgggt
gagcaccaattgagtctcccgggctggcaagccctgactctgccccctagtggcttgagg
ggtgaaagatctggcgtcctgaaactccagctggactgcagacccttgaaaggcaacaga
acagccgctggaccaccgaggcagcggctcctggacatggcgggacaccagcggcccttc
ctggagcttaagatgcgggccaatgagcctggagcaggccgagccaggaggaggactccc
acctgtgagcctgagactcccttatgttgtagacgagaccactatgtggacttccaggaa
ctgggatggcgggactggatcctgcagcctgaggggtaccacctgaattactgcagtggg
cagtgcccactccacctggctggcagcccgggcattgctgcttccttccattcggccgtc
ttcagtcttctcaaggccaataatccttggcctgcaggtacttcctgctgtgtccccact
gcccgaaggtccctttctctgctctacctcgaccataagagcaatgtggtcaagacagat
gtgccagatatggtggtggaggcttgtggctgcagctag

DBGET integrated database retrieval system