KEGG   Oryctolagus cuniculus (rabbit): 100359101
Entry
100359101         CDS       T03373                                 
Symbol
CDC16
Name
(RefSeq) cell division cycle 16
  KO
K03353  anaphase-promoting complex subunit 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04110  Cell cycle
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04914  Progesterone-mediated oocyte maturation
ocu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100359101 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100359101 (CDC16)
   04114 Oocyte meiosis
    100359101 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100359101 (CDC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100359101 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100359101 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100359101 (CDC16)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100359101 (CDC16)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100359101 (CDC16)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     100359101 (CDC16)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100359101 (CDC16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 TPR_16 SRP_TPR_like Dynein_light
Other DBs
NCBI-GeneID: 100359101
NCBI-ProteinID: XP_017195240
Ensembl: ENSOCUG00000008437
LinkDB
Position
Un
AA seq 605 aa
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDVYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDILDMEEPINKRLFEKYLKDESGLKDSSSD
WEMSPSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLDSLPLNKLCAEEQELLRFLFENKLKKYNKPGETVIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVLIIFLFFFFPNTELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGH
KNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYI
GLEYGLTNNSKLAERFFGQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKA
IGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGN
FENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKLKCYDFDVHTMKT
LKNIISPPWDFREFEVEKQTAEDTGLAPLDTSRKTPDSRPSLETFEIEMNESDMMLETSM
SDHSA
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgaacttggagaggctgcggaagcgcgtccggcagtacctggaccagcaacagtatcag
agtgctctgttttgggcagataaagtagcttccctctctcatgaggagccccaggacgtg
tattggctggctcagtgcctgtacctgaccgcacagtatcacagagcagcccatgcgctc
cgctctcggaaactggacaaactatatgaagcatgtcgataccttgcagctagatgccat
tatgctgcaaaagagcaccagcaggctctcgacattcttgatatggaggagccaatcaac
aaaagattatttgaaaaatacttgaaggatgagagtggtttgaaagactcctccagtgac
tgggagatgtcaccatcctcaataaagagttcaatttgtcttttacgagggaagatctat
gatgctctggataaccgaaccttagctacctacagctacaaagaagctttgaagctcgac
gtctactgttttgaggcatttgatcttttaacgtcacaccacatgttaacagcccaagaa
gaaaaagaacttcttgactcactacctcttaacaaactttgtgccgaagaacaggaattg
ctacgttttctatttgaaaacaaattaaaaaagtataataaacctggtgaaactgtcatt
cctgagtctgtagatggcctgcaggagaacctggatgtggtagtgtctttagcggagaga
cattattataactgtgactttaagatgtgctacaagcttacttctgtgttaattatattc
ctttttttctttttccctaatacagagcttttctatctgtctcataaactggtggattta
tatcccagtaatcctgtgtcttggtttgcagtgggatgttattatctcatggttggtcat
aaaaatgaacatgccagaagatacctcagcaaagctacaacgcttgagaagacgtacggg
cctgcgtggattgcctatggacattcatttgctgttgagagtgaacatgaccaggcgatg
gctgcctacttcacagcagcacagctcatgaaagggtgtcatttgccaatgctgtatatt
ggactagaatatggtttgacaaataactcaaaactggctgaaaggttctttggccaagct
ctgagcatcgcaccagaagacccctttgttatgcacgaggttggagtggttgcgtttcag
aatggagaatggaaaacagcagaaaaatggtttcttgatgctttggaaaaaattaaagca
attgggaatgaggtgactgttgacaaatgggaacctttgttgaacaacttgggacatgtc
tgcagaaaacttaagaagtacgcagaggctctggattaccaccggcaagccttggtgctg
attcctcagaatgcgtccacctattctgccattggatacatccacagtttgatgggcaac
tttgaaaatgctgtggactatttccacactgccctcggtcttaggcgagatgacacattt
tctgttacaatgcttggtcattgcattgagatgtacattggtgactccgaagcttatatc
ggagcagacattaaagacaaattaaaatgttatgactttgatgtgcatacaatgaagaca
ctaaaaaacattatttcacctccgtgggatttcagggaatttgaagtagaaaaacagact
gcagaagacacggggcttgcaccactggacacctccaggaagactccagattccagacct
tccttggaaacctttgaaattgagatgaatgagagtgacatgatgttagaaacatccatg
tcagaccacagcgcatga

DBGET integrated database retrieval system