KEGG   Oryctolagus cuniculus (rabbit): 103345715
Entry
103345715         CDS       T03373                                 
Symbol
PIN1
Name
(RefSeq) peptidylprolyl cis/trans isomerase, NIMA-interacting 1
  KO
K09578  peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04622  RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    103345715 (PIN1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    103345715 (PIN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ocu03021]
    103345715 (PIN1)
   03110 Chaperones and folding catalysts [BR:ocu03110]
    103345715 (PIN1)
Enzymes [BR:ocu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     103345715 (PIN1)
Transcription machinery [BR:ocu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     103345715 (PIN1)
Chaperones and folding catalysts [BR:ocu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    103345715 (PIN1)
SSDB
Motif
Pfam: Rotamase Rotamase_3 WW Rotamase_2 MBD
Other DBs
NCBI-GeneID: 103345715
NCBI-ProteinID: XP_008248975
LinkDB
Position
Un
AA seq 164 aa
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGGKIGQGEPARVRCSH
LLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKAR
GDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 495 nt   +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc
cgggtgtactacttcaaccacatcacgaacgccagccagtgggagcgccccagcggcaac
agcagcagcggtggaggcaaaatcgggcagggggagccggcgcgtgtccgctgctcgcac
ctgctcgtcaaacacagccagtcccggcggccctcgtcctggcggcaggagaagatcacc
cggaccaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcggga
gaggaggactttgagtctctggcctcgcagttcagcgactgcagctcggccaaggccagg
ggagacctgggtgccttcagcagaggtcagatgcagaagccattcgaagacgcctcgttt
gcgctgcggacaggggagatgagcgggcctgtgttcacggattccggcatccacatcatc
ttgcgcacagagtga

DBGET integrated database retrieval system