KEGG   Oryctolagus cuniculus (rabbit): 103347357
Entry
103347357         CDS       T03373                                 
Symbol
MADCAM1
Name
(RefSeq) mucosal vascular addressin cell adhesion molecule 1
  KO
K06779  mucosal vascular addressin cell adhesion molecule 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    103347357 (MADCAM1)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103347357 (MADCAM1)
SSDB
Motif
Pfam: Adhes-Ig_like Ig_3 ICAM_N Big_2
Other DBs
NCBI-GeneID: 103347357
NCBI-ProteinID: XP_008252083
LinkDB
Position
Un
AA seq 454 aa
VGGSGGAEAAGRGRARGALRPELRGTVAAGQPLRVEPSEPVVAVAVGASQRFNCSLACAD
GAAADVRWRGLDTSLGAVQSAVGRSTLTVHRASPAAAGTHVCVGSCGDLTFQRTVQLVVY
AFPDELTVSPPALVPGQDLQVACTAHNVTPWHPDFLSFSLLAGGQELEGAEALGLELGPE
EEEELLFHVTERWRLPALGTPGPRALRCQATMRLQGLELSRARDIPVLHGQTTLKTPGPT
SPEPPDPGPQEHPNQTSREPLHPISPKPLDPYSPNPTPQKPPNQTTSQEPPDPISPKPPD
PYSPNPTPRKPPDLTSWEPPDMASPTGTCRPKILQAPRPSAAKAHLELLCEVACGPGVAV
HWTLAPGGLAAYERTEAGARAWLRVPLTRDSPEGWFQCRMEPGGQVASLYVHGRQEAARP
PLALWTSGLALALLLLLAALASHLRRRCRRPAPR
NT seq 1365 nt   +upstreamnt  +downstreamnt
gtaggcgggtcggggggcgcggaggcggcggggcgggggcgggcgcgaggggccttgcgg
cccgagctcagaggcaccgtcgccgcaggccagcccctgcgggtggagccctcggagccc
gtggtggcggtggctgtgggcgcgtctcagcggttcaactgcagcctagcgtgcgccgac
ggcgctgcggccgacgtgcgttggcggggtctggacaccagcctgggcgcggtgcagtcg
gctgtgggcaggagcacgctcaccgtgcaccgcgcctcgcccgcggcggccggcacgcac
gtgtgcgtgggctcctgcggggacctcaccttccagcggaccgtgcagctcgtggtttac
gcctttcccgacgagctgaccgtgtccccgccggcactggtgcccgggcaggacctgcag
gtggcctgcacggcccacaacgtcaccccctggcaccccgacttcctctccttctccctg
ctcgctgggggccaggagctggagggggccgaggccctgggcctggagctgggccccgag
gaggaggaggagctgctgttccacgtgacggagcgctggcggctgccggccctggggacc
cccggcccgcgggccctgcgctgtcaggccaccatgaggctgcagggcctggagctgagc
cgggcccgggacatcccagtcctgcacggccagaccaccttgaagaccccagggccgacc
tcgcccgagcctccggatccaggaccccaggagcaccccaaccagacgtcccgggagccc
ctccacccaatctccccaaagcctctagacccatactcccccaacccgacccctcagaag
ccccccaaccagacgacgtcccaggagccccccgacccaatttccccaaagcctccagac
ccatactcccccaacccgacccctcggaagccccccgacctgacttcctgggagcccccc
gacatggcctcccccacagggacctgccgccccaagatcctccaggcgccccggccctcg
gcagcgaaggcgcacctggagctgctgtgcgaggtggcctgcggccctggcgtggccgtg
cactggaccctggccccggggggcctggcagcctacgagaggaccgaggctggggcccgg
gcctggctgagggtgcccctgaccagggacagccccgagggctggttccagtgtcgcatg
gagccagggggccaggtggccagcctgtatgtccacggcaggcaggaagccgcgaggccg
cccctggccctgtggaccagcggcctggcgctggcgctgctgctgctgctggctgccctc
gccagccacctgcggagacgctgccgccgccccgccccgcggtga

DBGET integrated database retrieval system