KEGG   Oryctolagus cuniculus (rabbit): 103351518
Entry
103351518         CDS       T03373                                 
Symbol
CCL1
Name
(RefSeq) C-C motif chemokine ligand 1
  KO
K05514  C-C motif chemokine 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351518 (CCL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351518 (CCL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351518 (CCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351518 (CCL1)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351518 (CCL1)
SSDB
Motif
Pfam: IL8 Fer4_15
Other DBs
NCBI-GeneID: 103351518
NCBI-ProteinID: XP_017204794
Ensembl: ENSOCUG00000013416
LinkDB
Position
19:complement(23794772..23797574)
AA seq 112 aa
MGQERDLSVSGARLPEMKLVPVALACLLLVAMWPQDVDGKSMHVSSSNCCFSFVEKRIPL
KTIHCYRRSSSTCPYDAIIFKLRGGRESCALKTVGWLQGYFKKMKPCLPKGP
NT seq 339 nt   +upstreamnt  +downstreamnt
atgggccaggagagagatctcagtgtctccggagcccgactgcccgagatgaagcttgtc
cccgtggctctggcgtgcctgctgctggtcgcgatgtggcctcaagacgtggatggcaag
agcatgcacgtatcctcctccaactgctgcttctccttcgtggagaaaaggattcccctg
aagaccatccactgctacagaaggagcagctccacctgcccctacgacgccatcatattc
aagctgagaggaggcagagaaagctgtgccttgaagacagtgggctggctccagggctac
tttaaaaagatgaagccctgcctgccaaagggaccctga

DBGET integrated database retrieval system