KEGG   Oryctolagus cuniculus (rabbit): 103352139
Entry
103352139         CDS       T03373                                 
Symbol
RHOD
Name
(RefSeq) ras homolog family member D
  KO
K07530  Ras homolog gene family, member D
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103352139 (RHOD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ocu04031]
    103352139 (RHOD)
GTP-binding proteins [BR:ocu04031]
 Small (monomeric) G-proteins
  Rho Family
   Others
    103352139 (RHOD)
SSDB
Motif
Pfam: Ras DUF4123
Other DBs
NCBI-GeneID: 103352139
NCBI-ProteinID: XP_017204299
LinkDB
Position
1:194563152..194564152
AA seq 242 aa
MERQEPDGAACELWQGTEGAQHRAQGPTLGSSPATSSWARLHSHYVPQLAHLHNGLGCAT
CCKDREGLEQAPSGSVLNAGRSREGACSPWLTPAPHPAAPQWYPEVTHFCKQVPIIVVGC
KTDLRKDRSLVNKLRKKRAEPVTYHRVGRAGRGGLGVRPPPDLSERGPAGSPLGGHGVGV
LSGSRSWQQVDNGWWNAARSHPGEGRRRSVRPGADAAHPLHRRGPEAQGPLCRLLFAACL
GY
NT seq 729 nt   +upstreamnt  +downstreamnt
atggagcgccaggagccagacggggcagcttgcgagctgtggcagggtacggagggggct
caacacagggctcagggccccaccctgggctccagtcctgccacttccagttgggcaagg
ttgcatagccactacgtgcctcagttagcacatctgcacaatgggcttggctgcgcaact
tgctgcaaggatcgagaggggttagagcaggcaccaagtggttccgtcctaaacgctggc
cgcagccgagagggagcgtgctcgccatggctcacgcccgccccacatcctgccgccccg
cagtggtacccggaggtgactcacttctgcaagcaggtgcccatcatcgtcgtgggctgc
aagacggacctgcgcaaggacaggtcgctggtgaacaagctgcggaaaaagcgagctgag
cctgtgacctaccacagggtaggacgcgcagggcggggagggctgggggtgcgcccaccg
ccagacctctcagagcgcgggcctgcggggagccccctggggggacacggggtgggggtg
ctgtcaggcagcaggagctggcagcaggtggacaatggctggtggaatgctgcaaggagt
caccctggagaagggagacgcaggagtgtccgtcccggagccgatgctgcccacccactt
cacagaaggggccccgaggctcaggggccgctctgcaggctgctgtttgcggcatgcctg
ggttactag

DBGET integrated database retrieval system