KEGG   Oryctolagus cuniculus (rabbit): 103352487
Entry
103352487         CDS       T03373                                 
Symbol
NGEF
Name
(RefSeq) neuronal guanine nucleotide exchange factor
  KO
K07525  neuronal guanine nucleotide exchange factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    103352487 (NGEF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    103352487 (NGEF)
Membrane trafficking [BR:ocu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103352487 (NGEF)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_9 SH3_2 PH SH3_16
Other DBs
NCBI-GeneID: 103352487
NCBI-ProteinID: XP_017192995
LinkDB
Position
Un
AA seq 473 aa
MFELVTSEASYYKSLSLLVSHFMENERLKKTLHPSEAHILFSNVLDVMAVSERCYAADPF
SVYITYVSNQTYQERTYKQLLQEKAAFXELIAQLELDPKCKGLPSLLLILPFQRSHACSP
DNHVLEEERLGVAGRTAQLGACPGLCTLVSWVAGPVSQPRAPWRGLHWCGRAGWGEADTD
APFLCAQNILKRVEERSEREGTALAAHRELEMVVKACNEGVRKMSRTEQMISIQKKMEFK
IKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFQEIYLFLFNDLLVICRQIPGDKY
QVFDSAPRGLLRVEELEDQGQTLANVFILRLLENADDREATYMLKASSQSEMRRWMTSLA
PNRRTKFVSFTSRLLDCPQVQCVHPYVAQQPDELTLELADILNVLDKTEDGWIFGERLHD
QERGWFPSSTTEEILNPKIRSQNLKECFRVHKMEDPQRSQNKDRRKLGSRNRQ
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtttgagctggtcacctccgaggcctcctactacaaaagcctgagcctgctggtgtcc
cacttcatggagaacgagcggctgaagaagaccctgcacccgtccgaggcgcacatcctc
ttctccaacgtgctggacgtcatggccgtcagcgagcggtgctacgccgccgaccccttc
tccgtctacatcacctacgtcagtaaccagacctaccaggagaggacctacaagcagctg
ctccaggagaaggccgcatttncggagctgatagcccagctggagcttgaccccaagtgc
aaggggctgccttcgctccttctcatcctgcccttccagagatcacacgcctgctcccca
gacaaccacgttctggaagaggagagactgggcgtggctgggaggacagcacagttaggg
gcctgcccagggttgtgtaccctggtctcgtgggtggcaggccccgtgtcccagccccgt
gccccgtggcgtggcctgcactggtgcggcagggcggggtggggggaggctgacactgac
gctccctttctctgtgctcagaacatcctgaagagggtggaggagcggtcggagcgggaa
ggcaccgccctggcggcccaccgcgagctggagatggtggtgaaggcgtgcaacgagggg
gtcaggaagatgagccgcacggagcagatgatcagcatccagaagaagatggagttcaag
atcaagtccgtgcccatcatctcgcactcccgctggctgctgaagcagggagagctgcag
cagatgtcgggccccaagacctcgcgcacgctgcggaccaagaagctcttccaggaaatt
tacctcttcctcttcaatgacctgctggtcatctgcaggcagatcccgggagacaagtac
caagtgtttgactcggcgccgcggggcctgctccgcgtggaggagctggaggaccagggc
cagacgctggccaacgtgttcatcctgcggctgctggagaacgcggacgaccgcgaggcc
acctacatgctgaaggcgtcctcccagagcgagatgaggcgctggatgacgtccctggcc
ccgaaccggaggaccaagttcgtctccttcacctcccggctgctggactgcccccaggtc
cagtgcgtgcacccgtacgtggcccagcagccagacgagctgacgctggaactcgctgac
atcctgaacgtcctggacaagacggaggacggctggatctttggtgagcggctgcacgac
caggagagaggctggttccccagctccacgaccgaggagatcctgaaccccaagatccgg
tcccagaacctcaaggagtgtttccgtgtccacaagatggaagaccctcaacgcagccag
aataaggaccgcaggaagctgggcagccggaatcggcaatga

DBGET integrated database retrieval system