KEGG   Oryctolagus cuniculus (rabbit): 103352517
Entry
103352517         CDS       T03373                                 
Symbol
CRLF2
Name
(RefSeq) cytokine receptor-like factor 2
  KO
K05078  thymic stromal-derived lymphopoietin receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103352517 (CRLF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103352517 (CRLF2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103352517 (CRLF2)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   103352517 (CRLF2)
SSDB
Motif
Pfam: fn3 Pur_ac_phosph_N Tissue_fac WW_FCH_linker C1-set
Other DBs
NCBI-GeneID: 103352517
NCBI-ProteinID: XP_008273625
LinkDB
Position
Un
AA seq 427 aa
MPRLSLFPSCHFILCSISASSPKGCGLHLSLTSRNLPTLHPGRSSLMCQSLISGAGMSCP
VHAAAPTAAIFLFIFLLGPREASGHLGTGQLGLQITCFNFQTVQITWDAGETSGSNLTFM
YRFQDDPAYVQCLHYSIHGSHTNGCLLSTAGDDILHFVLLNGSHALINRSQWLSDHLKPG
SPRDVSFQWEEEAVTVSCVQLPYSGILYEVQHRSTFDTEWQSQDAETCNVTIHGLDPDKC
YRFRVRARTKLSVYGPEAQPSEWSAISHWKRARPKDSCSDRAQGPKLTFIFVLASILSMG
LLFLSLWKLHSVKKFLVPTVPDPRSSFPGLFECHRGDFQQEWISDTQNVAPPDPMEDSAP
EHTLVIHLPRMDPQEVPGASNPGYPEVREQKATVDSPRLPRSPPESTSLEALAQPKFTLA
DTHYVVM
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgccgagactgagtctgtttccttcctgccattttatcctttgttccatctctgcctct
tcaccaaaggggtgtggcctccatctgtcactcaccagccgaaatctccccaccctccac
ccaggacgatcgtcactcatgtgtcagtctctcatttcgggagcaggcatgagctgccca
gtccacgcagcagcccccacagctgctatcttcctcttcatcttcctgctgggtcctcgg
gaggcttcggggcacctggggacagggcagctaggactccagatcacctgcttcaatttc
cagacggtacagatcacctgggatgctggcgaaacatctggaagcaacctgaccttcatg
tacaggttccaggatgaccctgcctatgtccagtgcctgcactacagcatccatggcagt
cacaccaacgggtgcctgctgtctaccgcgggcgatgacatcctgcactttgtgctcctc
aatggcagccacgccctcatcaaccgcagccagtggctcagcgaccacctgaagcccggc
tcaccccgtgatgtcagcttccagtgggaggaggaggcagtgactgtgagctgcgtgcaa
ctaccctacagcgggatcctgtacgaggtgcagcaccgtagcaccttcgacactgagtgg
cagtcccaggatgcggagacctgcaatgtcaccatccacggcctggatccagacaaatgc
taccgcttccgggtgcgagcgaggacgaagctgtctgtctatggccctgaggcccagccc
agcgagtggtcagctatcagtcattggaagcgggcacggccaaaagattcatgctcagac
agggctcagggccccaagctgaccttcatctttgtcctggccagcatcctgagcatgggc
ctcctctttctgtccctgtggaagttgcacagtgtcaagaaatttctcgtgcccactgtg
ccagaccccagatccagcttccccgggctcttcgagtgccaccgaggagatttccagcag
gagtggatctctgacacccagaatgtggcacctccggatccaatggaagacagtgccccg
gagcacacactggtcatccacctgcccaggatggacccccaggaggtgcctggggcatcc
aacccggggtaccctgaagttagggagcagaaagccactgtggactcccccaggctccct
cgctccccaccggaaagcaccagcctggaagccctggcacagcccaaattcacactggca
gacacacactatgtggtgatgtaa

DBGET integrated database retrieval system