KEGG   Oryx dammah (scimitar-horned oryx): 120854195
Entry
120854195         CDS       T07255                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
oda  Oryx dammah (scimitar-horned oryx)
Pathway
oda04927  Cortisol synthesis and secretion
oda04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oda00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    120854195
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    120854195
SSDB
Motif
Pfam: MRAP FixQ T4SS_pilin
Other DBs
NCBI-GeneID: 120854195
NCBI-ProteinID: XP_040083938
LinkDB
Position
Unknown
AA seq 167 aa
MAGRTNTSAPYYSYEYYLDYLDLMPVDEKKLSANKHSIAIAFWVSLAAFVVFLFLILLYM
SWSGSPQMRNATQQLPTCSWSLGLNLPLYVWRQSQRPRAPPGDPAASTELSRGTRRRSIP
ACPAAATRDTLHLGAPRTTLLSSGNWPLVGTHRAPADVSNMPSEPPL
NT seq 504 nt   +upstreamnt  +downstreamnt
atggctggcagaaccaacacctctgccccgtactacagctatgaatactacctggactac
ttggacctcatgcccgtggatgagaagaagctgagtgccaacaaacactcgatcgccatc
gccttctgggtgagcctggcagctttcgtggtttttctcttcctcatccttctctacatg
tcctggtcaggctctccacagatgaggaacgccacccagcagctcccaacatgttcctgg
agtcttggcctcaacctcccgctctatgtctggaggcaatcccagcgccccagggcccct
ccgggggaccctgcagcctccactgagctcagtcgtgggaccagacgccggagcatccca
gcctgtccagcggctgcaacgagagacaccctccacctcggcgcccccaggaccaccctg
ctctcctctgggaactggcccttggtggggacccacagggcaccagctgacgtcagcaac
atgcccagtgagcctcccctgtag

DBGET integrated database retrieval system