Oryx dammah (scimitar-horned oryx): 120859698 Help Entry 120859698         CDS       T07255                                  Name (RefSeq) C-C motif chemokine 17-like   KO K21083   C-C motif chemokine 17 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04061   Viral protein interaction with cytokine and cytokine receptor oda04062   Chemokine signaling pathway oda04625   C-type lectin receptor signaling pathway oda04657   IL-17 signaling pathway Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120859698    04061 Viral protein interaction with cytokine and cytokine receptor     120859698  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120859698    04657 IL-17 signaling pathway     120859698    04062 Chemokine signaling pathway     120859698  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120859698 Cytokines and neuropeptides [BR:oda04052]  Cytokines   Chemokines    120859698 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ribosomal_S4e Motif Other DBs NCBI-GeneID:  120859698 NCBI-ProteinID:  XP_040091638 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search MRTHTCSCLAFPTARAGSVGRECCLQFYKGSIPQKELVDWYRTSGNCPNNAIVLVTHSGR TICANPKDKKVKKAVKYLQKHMKSPNQAFQES NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgcgcacacatacctgttcctgcttggccttccccacagctcgagcaggcagcgtgggc cgggagtgctgcctacagttctacaaaggatctattccccaaaaggagctggtggattgg taccggacctcgggcaattgtcccaacaatgccattgtgctggtgactcactctggcaga accatttgtgcaaaccccaaggacaaaaaggtgaagaaggcagtgaagtacttgcagaaa cacatgaagtcacctaatcaggccttccaggagtcttga

DBGET integrated database retrieval system