Oryx dammah (scimitar-horned oryx): 120860132 Help Entry 120860132         CDS       T07255                                  Name (RefSeq) interferon beta-2-like   KO K05415   interferon beta Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04151   PI3K-Akt signaling pathway oda04217   Necroptosis oda04380   Osteoclast differentiation oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04622   RIG-I-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04630   JAK-STAT signaling pathway oda04650   Natural killer cell mediated cytotoxicity oda04668   TNF signaling pathway oda04936   Alcoholic liver disease oda05135   Yersinia infection oda05142   Chagas disease oda05152   Tuberculosis oda05160   Hepatitis C oda05161   Hepatitis B oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05165   Human papillomavirus infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05170   Human immunodeficiency virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120860132    04668 TNF signaling pathway     120860132    04151 PI3K-Akt signaling pathway     120860132   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120860132  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120860132  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120860132    04621 NOD-like receptor signaling pathway     120860132    04622 RIG-I-like receptor signaling pathway     120860132    04623 Cytosolic DNA-sensing pathway     120860132    04650 Natural killer cell mediated cytotoxicity     120860132   09158 Development and regeneration    04380 Osteoclast differentiation     120860132  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120860132    05161 Hepatitis B     120860132    05160 Hepatitis C     120860132    05171 Coronavirus disease - COVID-19     120860132    05164 Influenza A     120860132    05162 Measles     120860132    05168 Herpes simplex virus 1 infection     120860132    05163 Human cytomegalovirus infection     120860132    05167 Kaposi sarcoma-associated herpesvirus infection     120860132    05169 Epstein-Barr virus infection     120860132    05165 Human papillomavirus infection     120860132   09171 Infectious disease: bacterial    05135 Yersinia infection     120860132    05152 Tuberculosis     120860132   09174 Infectious disease: parasitic    05142 Chagas disease     120860132   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120860132   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120860132  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120860132 Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interferons    120860132 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Motif Other DBs NCBI-GeneID:  120860132 NCBI-ProteinID:  XP_040091877 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQRRSTAVCQKLLQQLPATTQHCLEARMNFQ VPEEMKQAQQFRKEDAVLVMYEMLQQIFHILTRDFSSTGWSDTIIEHLLEELYGQMNRLE PILKEIMQKQNSTMGDTTVLHLKKYYFNLVQYLKSKEYNRCAWTVMQMQLLRNFSFLKSL TGYLHD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacaaaggcggagcactgcggtgtgtcagaaa cttctgcagcagttacctgcaacaactcaacattgcctagaggccaggatgaacttccag gtgcctgaggagatgaagcaagcacagcagttccggaaggaagacgccgtgttggtcatg tatgagatgctccagcagatcttccatattctcaccagagacttctccagcactggctgg tctgacaccatcattgagcacctccttgaggaactctatgggcagatgaatcgtttggag ccaatcctgaaggaaataatgcagaagcaaaactccactatgggagacacgaccgttctt cacctgaagaaatattacttcaacctggtgcagtacctgaagtccaaggagtacaacagg tgtgcctggacagtcatgcaaatgcaactgctcaggaacttttctttcctgaagagccta acaggttacctccatgactga

DBGET integrated database retrieval system