Oryx dammah (scimitar-horned oryx): 120868635 Help Entry 120868635         CDS       T07255                                  Symbol GHRH Name (RefSeq) somatoliberin   KO K05260   growth hormone-releasing hormone Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04080   Neuroactive ligand-receptor interaction oda04081   Hormone signaling oda04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     120868635 (GHRH)    04081 Hormone signaling     120868635 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     120868635 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120868635 (GHRH) Cytokines and neuropeptides [BR:oda04052]  Neuropeptides   GPCR binding    120868635 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 RteC Motif Other DBs NCBI-GeneID:  120868635 NCBI-ProteinID:  XP_040103286 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MLLWVFFLVTLTLSSGSHGTLPSQPLRIPRYADAIFTNSYRKVLSQLSARKLLQDIMNRQ QGERNQEQGAKVRLGRQVDSVWTDQQQMALESILVSLLQERRNSQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctcgtgaccctcaccctcagcagcggctcccatggtacc ctgccctcccagcctctcaggatcccacggtatgcagatgccatcttcaccaacagctac cggaaggttctgagccagctgtctgcccgcaagctactccaggatatcatgaacaggcag cagggagagagaaaccaggaacaaggagcaaaggtacggcttggccgtcaggtggacagc gtgtggacagaccaacagcagatggcattggagagcatcttggtgagcctgctgcaagag cgcaggaattcccaaggatga

DBGET integrated database retrieval system