KEGG   Oryx dammah (scimitar-horned oryx): 120877740
Entry
120877740         CDS       T07255                                 
Symbol
ITGAX
Name
(RefSeq) LOW QUALITY PROTEIN: integrin alpha-X
  KO
K06462  integrin alpha X
Organism
oda  Oryx dammah (scimitar-horned oryx)
Pathway
oda04610  Complement and coagulation cascades
oda04810  Regulation of actin cytoskeleton
oda05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:oda00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    120877740 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    120877740 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    120877740 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:oda04515]
    120877740 (ITGAX)
   04090 CD molecules [BR:oda04090]
    120877740 (ITGAX)
Cell adhesion molecules [BR:oda04515]
 Integrins
  Integrin alpha subunits
   120877740 (ITGAX)
CD molecules [BR:oda04090]
 Proteins
  120877740 (ITGAX)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha
Other DBs
NCBI-GeneID: 120877740
NCBI-ProteinID: XP_040116039
LinkDB
Position
Unknown
AA seq 1166 aa
MPMSALLVMTVTQVFLFLLMAPVSFLCFNLDMEQPTTFHVDSPGFGHSVVQYAQWLVVGA
PQEVKAANQTGGLYWCDYSMGRCEAIPLQVPPEAVNMSLGLSMAATTDPFQLLACGPTVH
HTCQENMHLTGICFLLASPFQQVKRIPAALQECPRQDQDIAFLIDGSGSISSNDFNKMLN
FVKAVMSQFQRPSSQFSLVQFSNRFQEHFTFKDFATSSDPLNLLNSVRQLGGWTFTASAI
RFVTDRLLSAAYGARKDASKILIVITDGEKTEQVDYKDVIPRAEAAGIIRYAIGVGSAFR
YRNSLQELINIASTPPEEHVFQVENXDALRDIQKQLKEKIFAIEGTQTISSSSFELEMSQ
EGFSGVFMPDGPVLGAVGSFSWSGGAFLYPQNKNPTFINMSQEHVDMRDSYLGYSTELAL
WKGVQSLILGAPRHQHTGKVVLFTQVSGQWKPKAEVTGTQIGSYFGASLCSVDVNGDSSS
DLVLIGAPHLYEQSQGGQVSVCPFPRGRAKWKCDAVLRGEPGHPWGRFGAALTALGDVNG
DRLADVAIGAPGEQENQGAVYLFHGTSELGISPSHSQRVTGTQLSPSLQYFGQSLSGGRD
LTQDGLADLAVGAQGHALLLRTRPVLRMWANIHITPVEIARSVYECEQLATFPHDLGKAT
VCLHVSQSPKNQLVNLQSIVTFDLTLDPGRLSPRAIFQETGTRNLTRVQELGLKQHCEAV
RLLLPDCVEDSVTPIILRLNFSLVGKPISSLRNLQPMLAVDAQRYFTTSLPFEKNCGADH
VCQDDLSISFGVSELKTLMVGSNLELNLKVRVWNDGEDSYGTAVTFFYPPGLSYRHVTGG
QNHLQSRSLRLTCDSAPAGTQGTRSTRCSFNHFIFREGAQITFTVTFHVSPMATLGDKLL
LAANVSSENNSPKTSKTTFQLELPVKYAVYTVISSHEQSTKYLNFSASQEEGSREAQHRY
QVNNLGQRELPVSIDISVPMELNQVAVWKDIEVLNPQNPSIQCSSERTAPTESDFLTHFK
KKPVLDCSIADCLRFHCDIPSFGIQEELDFILKGNLSFRWVSQTQQKKVLVVSVAEITFN
RLVYSQLPGQETFLRAQTELVLEKYEVYNPIPLIVGSSVGGLLLLALITALLYKVGFFKR
QYREMMEEANKQTIPENETRDPQVAQ
NT seq 3501 nt   +upstreamnt  +downstreamnt
atgcctatgtctgcccttcttgtcatgacggtgacccaggtttttctgttcctgttgatg
gccccggtgtcctttctctgcttcaacttggacatggagcaaccgacaaccttccatgtg
gacagccctgggtttggacacagtgtggtccagtatgcccaatggctggtggttggagcc
ccccaggaggtaaaggctgccaaccaaacaggcggcctctactggtgcgactacagcatg
ggcaggtgtgaggccatccccctgcaggtgcctccagaggctgtgaacatgtccctgggc
ctgtccatggcagccaccaccgacccctttcagctgctggcctgtggccccactgtgcac
cacacatgccaggagaacatgcacttgaccgggatctgcttcctgctggcctccccgttc
cagcaggtcaagaggatcccggctgccctgcaggagtgcccaaggcaggatcaggacatc
gccttcctgatcgacggctcaggcagcatctcctccaacgattttaacaaaatgttgaac
ttcgtgaaggccgtgatgagccagttccagcgtcccagctcccagttctccctggtgcag
ttctccaaccggttccaggagcacttcactttcaaagacttcgctaccagctcagaccca
ctaaacctcctgaattccgtccggcagctgggagggtggacgttcacggcctcagccatc
cgattcgtcacagatcgactgctcagtgccgcctacggggccagaaaagacgcctccaaa
atcctcatcgtcatcactgatggggagaaaacagaacaggtggattacaaggatgtcatt
ccccgggctgaggccgccggcatcatccgatatgcaattggggtgggatcagcatttcga
tacagaaattccttgcaagaattaatcaacattgcctccacaccccctgaagagcatgta
tttcaagtggagaacnntgatgctttgcgagacattcagaaacaactgaaagagaagatc
tttgccattgagggtacgcagaccataagcagtagttccttcgaactggagatgtctcag
gagggcttcagtggtgtgttcatgcctgatggaccagttctgggggctgtggggagcttc
agctggtctggaggtgccttcctgtacccccaaaataagaaccccaccttcatcaacatg
tcccaggagcacgtggacatgagggactcttacctgggttactccacagagctggccctt
tggaagggggtccagagcctgatcctgggggccccccgccatcagcacaccgggaaggtg
gtcctcttcacccaggtgtccgggcaatggaagccgaaggctgaagtcacagggacccag
atcggctcctacttcggggcctccctctgctccgtggacgtgaatggagacagtagctct
gacctggtcctcatcggggcccctcatctctacgagcagagccaggggggccaggtgtcc
gtgtgcccctttccccgggggagagctaagtggaagtgtgatgctgtcctgcgaggggag
ccgggccacccctggggccgctttggggcagccctgaccgccctgggggatgtgaatggg
gacaggctggcggatgtggccattggggccccgggagagcaggagaaccagggtgctgtc
tacctgttccacggaacctcagaactgggcatcagcccctcccacagccagcgggtcaca
ggcacccagctctcccccagcctccagtatttcgggcagtcgctgagcgggggtcgggac
ctcacccaggatggactggcagacttggccgtgggggcccaggggcatgcattgctgctc
aggaccagacctgtgctcaggatgtgggcgaacattcacatcacacccgtggagatcgcc
aggtctgtgtatgagtgtgagcagctggcgacctttccccatgatctgggcaaggccact
gtctgcctgcatgtttcccaaagtcccaagaaccagctggttaacctccaaagcattgtg
acctttgacctaacccttgaccctggccgcctgagtcctcgtgccatcttccaagagacg
gggactcggaatctgacccgtgttcaagagctggggctgaagcagcactgcgaggctgtg
aggttgctccttccggactgtgtggaggactcagtgacccccatcatcttgcgtctcaac
ttctccctggtgggcaagcccatctctagcctaagaaacctgcagcctatgctggcagtg
gatgcccagagatacttcacaacttctctcccctttgagaagaactgtggtgcggatcat
gtctgccaggatgacctcagcatctcctttggggtctcagagttgaagaccctgatggtg
gggagtaacctggagctgaacttgaaagtgagagtgtggaatgatggtgaggactcctat
ggaaccgcagtcaccttcttctaccctccagggttgtcttaccgacatgtgaccgggggc
cagaaccatctgcagtcacgttccctgcgcctgacctgtgacagcgcccccgccgggacc
cagggcacccgaagcacccgctgtagcttcaaccacttcatcttccgtgagggcgcccag
atcaccttcacggtcacctttcacgtctcccccatggccaccctgggagacaagctgctt
cttgccgccaatgtgagcagtgagaataacagccccaagacaagcaagaccaccttccag
ctggagctgcccgtgaagtatgccgtctacaccgtgatcagcagccacgaacaatccacc
aagtacctcaacttctcggcctcacaggaggagggcagcagggaggcccagcacagatac
caggtgaataatctggggcagagggagctgcccgtcagcatcgacatctcagtgcccatg
gagctgaaccaggtggccgtgtggaaggacatagaggtcctcaacccccagaacccctcc
attcagtgctcttcagagagaacagcgcccacagagtctgacttcctgacccactttaag
aagaagcctgtcctggactgctccatcgctgactgcctgaggttccactgtgatatcccc
tccttcggcatccaggaggaacttgacttcatcctgaagggcaacctcagcttccgctgg
gtcagccagacacagcagaagaaggtgctggtcgtgagcgtggctgaaatcaccttcaac
agacttgtgtattctcagcttccaggacaggagacatttttgagagctcagacggagctg
gtgctggagaagtatgaggtctacaaccccatccccctcattgtgggcagctccgtggga
gggctgctgctcctggccctcatcacagccctgctgtacaaggttggtttcttcaaacgt
cagtacagggagatgatggaagaagcaaacaaacagactatcccagaaaatgagaccaga
gacccccaagttgcccaataa

DBGET integrated database retrieval system