KEGG   Ostrinia furnacalis (Asian corn borer): 114363095
Entry
114363095         CDS       T07986                                 
Name
(RefSeq) methylenetetrahydrofolate reductase
  KO
K25009  methylenetetrahydrofolate reductase [NAD(P)H] [EC:1.5.1.20]
Organism
ofu  Ostrinia furnacalis (Asian corn borer)
Pathway
ofu00670  One carbon pool by folate
ofu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ofu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    114363095
Enzymes [BR:ofu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     114363095
SSDB
Motif
Pfam: MTHFR Lipoprotein_7
Other DBs
NCBI-GeneID: 114363095
NCBI-ProteinID: XP_028174520
LinkDB
Position
Unknown
AA seq 273 aa
MAKVTDLIANCYQQKVTFSIEVTPDVSTSELDSLSIEPLFYSITWHAKTHKNENLDIAPL
RLARYLRNKNKEVLMHLSCDMLRKEFLLQLLDTFKEIKVCNLFVVLGEGFNPQSSDFQNS
EELIKTIRNETGDYFCIGVAGLPDCSDEKLLQLKHKVDIGANFVLTQAFFESKIYENFIK
RSKSAGINVPIIPGVFPFETYQQLSGFINMCKIKASQDILDYVKNQDQSEEIPGKKITQN
LIKSIATGTKMKHFHLFSINRLSTVVSIVQPLL
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcaaaagtcactgacttgatagcaaactgctaccaacagaaggtgacattctctatc
gaagtgaccccagacgtatcaacatcagagttggacagtctatccatagagccactgttc
tactccataacttggcatgcgaagacccataagaatgaaaacctggacatcgccccattg
cgattggcgagatatctaagaaataaaaataaagaggtcctgatgcatctgtcgtgcgat
atgctcaggaaggagttcttgctccagttactagatacttttaaggaaataaaagtttgc
aacctgtttgttgttttaggtgaagggttcaatccacaatcgtcagactttcaaaatagc
gaagaactaatcaaaacaatcagaaatgaaacaggagattacttttgcattggggtggca
ggcctgcccgactgcagtgacgaaaaattactacaactaaaacacaaagtcgacatcggc
gctaacttcgtactaacacaagccttcttcgagtccaaaatatatgagaactttatcaag
aggtctaaatccgccggaattaatgtgcctattattccaggagtattcccattcgaaacg
taccaacagctatcaggatttattaacatgtgcaaaataaaagcctcgcaagatatttta
gattacgtcaagaaccaggaccaatcggaagaaattccaggaaaaaagataactcaaaat
ttaatcaaatcgatagcaactggaactaagatgaaacattttcatttgttttctataaat
cgcctgtctaccgttgtttctattgttcagccattattgtaa

DBGET integrated database retrieval system