Otolemur garnettii (small-eared galago): 100967196 Help Entry 100967196         CDS       T07855                                  Symbol RAB5B Name (RefSeq) ras-related protein Rab-5B   KO K07888   Ras-related protein Rab-5B Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04014   Ras signaling pathway oga04137   Mitophagy - animal oga04144   Endocytosis oga04145   Phagosome oga04148   Efferocytosis oga04962   Vasopressin-regulated water reabsorption oga05132   Salmonella infection oga05146   Amoebiasis oga05152   Tuberculosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100967196 (RAB5B)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100967196 (RAB5B)    04145 Phagosome     100967196 (RAB5B)    04137 Mitophagy - animal     100967196 (RAB5B)    04148 Efferocytosis     100967196 (RAB5B)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     100967196 (RAB5B)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100967196 (RAB5B)    05152 Tuberculosis     100967196 (RAB5B)   09174 Infectious disease: parasitic    05146 Amoebiasis     100967196 (RAB5B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     100967196 (RAB5B)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oga04147]     100967196 (RAB5B)    04031 GTP-binding proteins [BR:oga04031]     100967196 (RAB5B) Membrane trafficking [BR:oga04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     100967196 (RAB5B)  Endosome - Lysosome transport     100967196 (RAB5B) Exosome [BR:oga04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100967196 (RAB5B)   Exosomal proteins of other body fluids (saliva and urine)    100967196 (RAB5B)   Exosomal proteins of colorectal cancer cells    100967196 (RAB5B)   Exosomal proteins of melanoma cells    100967196 (RAB5B) GTP-binding proteins [BR:oga04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     100967196 (RAB5B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SDR-like MCR_beta Motif Other DBs NCBI-GeneID:  100967196 NCBI-ProteinID:  XP_023369416 Ensembl:  ENSOGAG00000007054 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTGKAVGPWCYHSSAHLQHLPLSILLSTAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLA PMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYE EAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQ QNKSQCCSN NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacaggaaaagcagttggcccatggtgttaccattcatccgcccacttacaacatctt cccctctctattctcttatccacagcggccttcctcacccaatcagtttgtctagatgac accacagtcaagtttgagatctgggacacagctgggcaggagcgataccacagcttagct cctatgtactacaggggtgcccaagctgcaattgtggtttatgacattactaatcaggaa acttttgcccgagcaaagacatgggtaaaggaactacagcgacaggccagtcccagcatt gttattgccctggcagggaacaaagctgacctagccaacaagcgcatggtggagtatgaa gaggcccaggcatatgcagatgacaacagcttattgtttatggagacttcagccaagact gctatgaatgtgaatgatctcttcctggcaatagctaagaagttgccaaagagtgaaccc cagaatctggggggtgcagcaggccgaagccggggtgtggatctccatgaacagtcccag cagaacaagagccagtgttgtagcaactga

DBGET integrated database retrieval system