Oncorhynchus gorbuscha (pink salmon): 124033630 Help Entry 124033630         CDS       T07892                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo04010   MAPK signaling pathway ogo04137   Mitophagy - animal ogo04140   Autophagy - animal ogo04218   Cellular senescence ogo04371   Apelin signaling pathway ogo04625   C-type lectin receptor signaling pathway ogo04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ogo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     124033630 (rras2)    04371 Apelin signaling pathway     124033630 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     124033630 (rras2)    04137 Mitophagy - animal     124033630 (rras2)   09143 Cell growth and death    04218 Cellular senescence     124033630 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     124033630 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     124033630 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     124033630 (rras2)    04031 GTP-binding proteins [BR:ogo04031]     124033630 (rras2) Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    124033630 (rras2)   Exosomal proteins of bladder cancer cells    124033630 (rras2) GTP-binding proteins [BR:ogo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     124033630 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 RsgA_GTPase SLFN-g3_helicase FeoB_N Motif Other DBs NCBI-GeneID:  124033630 NCBI-ProteinID:  XP_046201708 LinkDB All DBs Position LG04:complement(9882345..9930175) Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcagggtggaaggacggctcggtgcaggagaagtatcgactggttgtggttggaggt ggtggtgtcggaaagtcagccctaactatacaatttatccagtcctactttgtcactgac tatgatcccacgattgaagactcgtatacgaagcagtgtgtcattgacgagagggcggcc cggcttgacatcctggacacggccggacaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgcttgtcttctcagtcactgacagaggaagctttgaa gaaatctacaaatttcaaagacagatcctcagagtcaaagaccgggatgaatttcccatg atccttgtaggcaataaagcagacctggagcttcagagacaggtgacccaggaggagggc cagcagctggccagacagctcaaggtgacgtatatggaggcctcagccaaaatccgtatg aatgtagaccaggctttccacgagctggttagagtcatcaggaaattccaggaacaggaa tgcccgccctcgccagaacccacgcggaaagaaaaggacaagagtggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system