Oncorhynchus nerka (sockeye salmon): 115129128 Help Entry 115129128         CDS       T07952                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04068   FoxO signaling pathway one04081   Hormone signaling one04114   Oocyte meiosis one04140   Autophagy - animal one04150   mTOR signaling pathway one04810   Regulation of actin cytoskeleton one04910   Insulin signaling pathway one04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115129128    04068 FoxO signaling pathway     115129128    04150 mTOR signaling pathway     115129128   09133 Signaling molecules and interaction    04081 Hormone signaling     115129128  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115129128   09143 Cell growth and death    04114 Oocyte meiosis     115129128   09142 Cell motility    04810 Regulation of actin cytoskeleton     115129128  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     115129128    04914 Progesterone-mediated oocyte maturation     115129128  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:one04052]     115129128 Cytokines and neuropeptides [BR:one04052]  Neuropeptides   Unclassified    115129128 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  115129128 NCBI-ProteinID:  XP_029515093 LinkDB All DBs Position LG5:1891790..1894269 Genome browser AA seq 92 aa AA seqDB search MGPVFPGGLLSSQHLCGSHLVDALYLVCGEQGFFYNPHRPTPATPYRKSRQGWRVKLERP WKDHEDQKVKRGIVEQCCHKPCSFSHLQSYCD NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgggtcctgtcttccccgggggtctgctcagctcccagcacctgtgtggctcacacctg gtggatgccctctacctggtctgtggggaacaagggttcttctataacccccacagacct actcctgcaacaccttataggaagagcagacagggttggagggtgaagctggaacgtcca tggaaggaccatgaagaccagaaggtgaaaagaggcattgtggaacagtgctgtcataag ccatgtagcttcagccacctgcagagctactgcgactga

DBGET integrated database retrieval system