Oncorhynchus nerka (sockeye salmon): 115129686 Help Entry 115129686         CDS       T07952                                  Name (RefSeq) ras-related protein M-Ras-like   KO K07831   Ras-related protein M-Ras Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one04010   MAPK signaling pathway one04137   Mitophagy - animal one04140   Autophagy - animal one04218   Cellular senescence one04371   Apelin signaling pathway one04625   C-type lectin receptor signaling pathway one04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:one00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115129686    04371 Apelin signaling pathway     115129686  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115129686    04137 Mitophagy - animal     115129686   09143 Cell growth and death    04218 Cellular senescence     115129686   09142 Cell motility    04810 Regulation of actin cytoskeleton     115129686  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115129686  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:one04031]     115129686 GTP-binding proteins [BR:one04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115129686 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 GTP_EFTU RsgA_GTPase Arf AAA_16 AAA_24 Motif Other DBs NCBI-GeneID:  115129686 NCBI-ProteinID:  XP_029516169 LinkDB All DBs Position LG5:complement(30844209..30847368) Genome browser AA seq 161 aa AA seqDB search MAVTMATSTVLSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEI DAQWAILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDR WDLLLPCPLVAVARTTGGGERMCLFVLESVGLSDNREKKGK NT seq 486 nt NT seq  +upstreamnt  +downstreamnt atggctgtcactatggcaacgagcactgttctcagtgacaatctccccacgtataagctg gtagtggtgggggatgggggagtggggaagagtgctctcaccattcagttctttcagaag atctttgtccctgattacgaccccaccatcgaggactcctacctcaaacacactgagatt gatgcccagtgggccatattggacgttctggatacagcaggccaagaggagttcagtgct atgagggaacagtacatgaggactggggacgggttcctcatcgtgttctctgtcacagac aaggccagctttgaacatgtggaccgcttccatcaactcatcctcagggtgaaggaccgg tgggatttactacttccctgcccactggtggccgtggccaggacaacaggaggaggggag aggatgtgtctgtttgtgttggaatcagtgggcctgtcagacaacagagagaagaaggga aagtga

DBGET integrated database retrieval system