KEGG   Orcinus orca (killer whale): 101278209
Entry
101278209         CDS       T05247                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04927  Cortisol synthesis and secretion
oor04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:oor00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101278209 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101278209 (MRAP)
SSDB
Motif
Pfam: MRAP ABC2_membrane_4 ORC6
Other DBs
NCBI-GeneID: 101278209
NCBI-ProteinID: XP_004264693
LinkDB
Position
Unknown
AA seq 191 aa
MANRTNASAAYDSYEYYLDYLDLIPVDEKKLKASKHSIVIAFWVSLAAFVVFLFLLLLSM
SWPASPQTRKRESPKHHPTCPWSLGLNLPFCVWKQPQHHGAPQGTPLPLPSSVEEPGGRA
SGPVQQLQQESPSTSAPFHPPGPPCSPLGIGPRWGPARHQLMSGTSSPGSLPCRQNLPTV
EPTTQTRAIAE
NT seq 576 nt   +upstreamnt  +downstreamnt
atggccaaccggaccaatgcctctgccgcatacgacagctacgaatactacctggactac
ttggacctcattcccgtggatgagaagaagctgaaggccagcaaacattcgatcgtcatc
gccttctgggtgagcctggcagctttcgtggtcttcctgttcctgctgcttctgtccatg
tcctggccagcctccccgcagacgaggaaaagggaaagccccaagcaccacccaacgtgc
ccctggagtctcggcctcaacctccccttctgtgtctggaagcaaccccagcaccacggg
gccccccaggggaccccgctgcctctaccgagctcggtcgaggaaccaggtggcagagcg
tcgggccccgtccagcagctgcagcaggagagtccctccacctcggcccccttccacccc
ccagggccaccctgctctcctctgggaattggccctcgatggggacctgcacggcaccag
ctgatgtcaggaacttcaagcccagggagcctcccctgcagacagaacctcccgacggta
gaaccaacaacccaaaccagggccattgctgagtga

DBGET integrated database retrieval system