KEGG   Orcinus orca (killer whale): 101285445
Entry
101285445         CDS       T05247                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
oor  Orcinus orca (killer whale)
Pathway
oor04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:oor00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101285445 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oor04050]
    101285445 (TNFRSF8)
   04090 CD molecules [BR:oor04090]
    101285445 (TNFRSF8)
Cytokine receptors [BR:oor04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101285445 (TNFRSF8)
CD molecules [BR:oor04090]
 Proteins
  101285445 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101285445
NCBI-ProteinID: XP_012389400
LinkDB
Position
Unknown
AA seq 488 aa
MFCGTSVVNSCARCLPHSVCPTGMVVKFQGTAQRNTVCELPSPGASPNCSASPQDCKAPA
SSTIPQAKPTLTSPASSDARTTLLGGGAPLAPEDASKITAHSSSSVGRLSPDPGLTLQQP
CPQGSADCRKQCDPDYYLDRDGRCTACVSCSGDHLVEKTPCMWNSSRVCECRPGMFCATS
ASNSCARCVIRPICPPGMVTKLQGTAERDTTYEPPPLGTHSNCSTNAEDSGVPASPTPSL
ISLADSLTGKERGGDVTHVRGRASLSTSTPISFSSTGKPTLVSGPVLFWVILTLVVVVSF
GSFLLCHRRGCRKWMGQKLHLCYPVQTFQPKLEPVDSRPGRNPTLIGRVSVAEPGLEEQG
LTSPPAVETCPNLESLQLLEASPASSPSTSMDLPEPRGTAEHTNNRIENIYIMKADTVIV
GTVKAKVPEGQGLVGPAGSEFEEDLEVDHAPHYPEQETEPLAGSCGDVMFSVEEEGKEDP
LPTTASGK
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgttctgtggcacatcagtcgtcaactcctgtgcccgctgcctccctcactctgtctgc
ccaacggggatggttgtcaagttccagggcacagcgcaaaggaacactgtctgtgagctg
ccttccccaggggccagccccaactgcagcgccagcccacaggactgcaaggcccctgcc
agcagcaccatcccccaggccaagcccaccctgacctctccagcaagctctgatgccagg
accacacttctcggagggggcgcccccctcgccccagaagatgcttctaaaatcactgcc
cactctagctcctccgtggggaggctcagtccagatccagggctgaccctgcaacagcca
tgccctcaggggtctgccgactgtaggaagcagtgtgaccctgactactacctggacagg
gacggtcgctgcacggcctgtgtgagctgttcaggagaccacctcgtggagaagacacct
tgcatgtggaactcctcccgcgtctgcgagtgtcgacctggcatgttctgtgccacatcg
gcctccaactcctgtgcccgctgcgtcatccgccccatctgcccaccagggatggtcacc
aagctccagggtacggctgagagggacaccacctatgagccacctcccctggggacccac
tctaactgcagcaccaacgcagaggacagcggggtgcccgccagccccaccccctccctg
atctccctggccgactccctgactggtaaggagcgtggaggggacgtcacccacgtgcgg
ggacgcgcctctctctcaaccagcactcctatatccttctcctccacagggaagcccact
ctggtttcaggacctgtgctcttctgggtgatcttgacactggtggtggtcgtcagcttt
ggctcctttctcctgtgccaccggaggggctgcaggaagtggatggggcagaagctccac
ctgtgctacccagtccagaccttccagcccaagctggagcctgtggattccaggcccggg
aggaacccgacactgatcgggagggtatcggtggcagagccgggccttgaggagcagggg
ttaacgagccccccagctgtggagacctgccccaacctggagagcctgcagctgctggag
gccagcccagccagcagcccctccacctccatggaccttcctgagccccgagggaccgcg
gagcacaccaacaacaggattgagaacatctacatcatgaaggccgacactgtgattgtg
gggaccgtgaaggccaaggtgcctgagggccagggcctggtggggccggcagggtccgag
ttcgaggaggatctggaggtggaccatgccccccactacccagagcaggagacggaacca
ctggcgggcagctgtggggacgtcatgttctcggtggaggaggaagggaaggaggacccc
ttgcccacgaccgcctctgggaaatga

DBGET integrated database retrieval system